OPENSEQ.org - YEGP - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YEGP - UPF0339 protein YegP

UniProt:	P76402	Sequence MAGWFELSKSSDNQFRFVLKAGNGETILTSELYTSKTSAEKGIASVRSNSPQEERYEKKTASNGKFYFNLKAANHQIIGSSQMYATAQSRETGIASVKANGTSQTVKDNT	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14059
Length:	110 (110)
Sequences:	198
Seq/Len:	1.80

YEGP
Paralog alert: 0.03 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
53_E	98_K	2.332	1.00
7_L	39_A	2.157	0.99
65_K	82_Q	1.977	0.99
10_S	16_R	1.871	0.98
35_S	38_S	1.81	0.97
58_K	91_E	1.768	0.96
69_N	80_S	1.757	0.96
58_K	90_R	1.679	0.95
57_E	71_K	1.652	0.94
96_S	100_N	1.606	0.93
8_S	16_R	1.574	0.92
61_A	65_K	1.568	0.92
85_A	89_S	1.529	0.91
61_A	83_M	1.527	0.91
14_Q	31_E	1.524	0.90
66_F	89_S	1.515	0.90
95_A	99_A	1.464	0.88
6_E	109_N	1.453	0.87
16_R	32_L	1.439	0.87
8_S	18_V	1.436	0.87
10_S	14_Q	1.398	0.85
101_G	104_Q	1.382	0.84
51_P	56_Y	1.376	0.83
8_S	32_L	1.342	0.81
5_F	89_S	1.34	0.81
65_K	85_A	1.331	0.80
12_D	16_R	1.326	0.80
14_Q	32_L	1.305	0.78
4_W	107_K	1.294	0.78
21_A	96_S	1.269	0.76
28_L	79_G	1.268	0.76
5_F	104_Q	1.267	0.76
10_S	32_L	1.2	0.70
66_F	86_T	1.197	0.69
66_F	85_A	1.186	0.68
34_T	38_S	1.166	0.67
22_G	100_N	1.159	0.66
4_W	24_G	1.153	0.65
50_S	101_G	1.146	0.65
60_T	87_A	1.123	0.62
12_D	32_L	1.116	0.62
59_K	67_Y	1.101	0.60
23_N	93_G	1.097	0.60
59_K	62_S	1.097	0.60
89_S	92_T	1.093	0.59
27_I	93_G	1.079	0.58
53_E	58_K	1.07	0.57
18_V	29_T	1.07	0.57
3_G	13_N	1.068	0.57
23_N	96_S	1.06	0.56
42_G	45_S	1.045	0.54
58_K	95_A	1.032	0.53
14_Q	44_A	1.026	0.52
47_R	104_Q	1.022	0.52
68_F	81_S	1.002	0.49
9_K	59_K	1.001	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2k49A	1	1	100	0.14	Contact Map	0.533
2k8eA	1	1	100	0.161	Contact Map	0.519
2k7iA	2	0.7182	99.7	0.582	Contact Map	0.521
3bidA	8	0.5182	99.6	0.625	Contact Map	0.618
3u1wA	3	0.9636	13.3	0.938	Contact Map	0.108
3dc8A	2	0.3909	9.5	0.941	Contact Map	0
2rp4A	4	0.6273	8.4	0.943	Contact Map	0.292
2yugA	1	0.7545	8	0.944	Contact Map	0.232
2ftyA	4	0.4091	5.3	0.948	Contact Map	0.15
3kdwA	1	0.3727	5.2	0.948	Contact Map	0.132

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.