OPENSEQ.org - YEAC - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YEAC - Uncharacterized protein YeaC

UniProt:	P76231	Sequence MNLDDIINSMMPEVYQRLSTAVELGKWPDGVALTEEQKENCLQLVMLWQARHNIEAQHMTIDTNGQMVMKSKQQLKEDFGISAKPIAMFK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13489
Length:	90 (90)
Sequences:	133
Seq/Len:	1.48

YEAC
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
35_E	39_E	2.075	0.98
61_I	67_M	1.839	0.96
7_I	14_V	1.811	0.96
86_I	89_F	1.774	0.95
62_D	68_V	1.732	0.94
17_R	28_P	1.651	0.92
2_N	9_S	1.551	0.88
24_L	63_T	1.531	0.87
6_I	67_M	1.514	0.87
77_E	88_M	1.513	0.87
53_N	56_A	1.5	0.86
74_Q	78_D	1.462	0.84
24_L	88_M	1.329	0.75
85_P	90_K	1.301	0.73
73_Q	77_E	1.293	0.72
78_D	83_A	1.287	0.72
3_L	47_L	1.262	0.70
31_V	38_K	1.248	0.68
16_Q	19_S	1.247	0.68
29_D	89_F	1.234	0.67
78_D	87_A	1.228	0.67
83_A	87_A	1.225	0.66
78_D	84_K	1.193	0.63
39_E	57_Q	1.181	0.62
2_N	5_D	1.168	0.61
44_L	51_R	1.165	0.61
33_L	43_Q	1.16	0.60
16_Q	60_T	1.16	0.60
60_T	87_A	1.147	0.59
4_D	7_I	1.135	0.58
18_L	41_C	1.134	0.57
83_A	88_M	1.109	0.55
33_L	71_S	1.096	0.54
24_L	38_K	1.094	0.53
57_Q	78_D	1.092	0.53
83_A	89_F	1.064	0.50
16_Q	73_Q	1.06	0.50
20_T	24_L	1.056	0.49
42_L	51_R	1.054	0.49
13_E	38_K	1.054	0.49
35_E	63_T	1.054	0.49
47_L	53_N	1.051	0.49
32_A	40_N	1.05	0.49
57_Q	81_I	1.047	0.49
60_T	88_M	1.035	0.47
20_T	51_R	1.027	0.46
23_E	58_H	1.025	0.46
6_I	44_L	1.01	0.45
62_D	67_M	1.004	0.44
85_P	88_M	1	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
3sxyA	2	0.9444	33.6	0.919	Contact Map	0.321
3o6xA	6	0.8667	28.2	0.922	Contact Map	0.151
2di3A	2	0.8444	22.6	0.926	Contact Map	0.262
3c7jA	2	0.9778	21.9	0.926	Contact Map	0.158
1hw1A	2	0.9	18.9	0.928	Contact Map	0.202
1zbdB	1	0.6	18.8	0.928	Contact Map	0.098
2hs5A	1	0.9111	16.9	0.93	Contact Map	0.229
3ihuA	2	0.9667	13.1	0.933	Contact Map	0.231
4mgrA	4	0.9222	13	0.934	Contact Map	0.229
3by6A	5	0.9556	12.2	0.934	Contact Map	0.242

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0609 seconds.