OPENSEQ.org - YNJA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YNJA - Uncharacterized protein YnjA

UniProt:	P76222	Sequence MGLPPLSKIPLILRPQAWLHRRHYGEVLSPIRWWGRIPFIFYLVSMFVGWLERKRSPLDPVVRSLVSARIAQMCLCEFCVDITSMKVAERTGSSDKLLAVADWRQSPLFSDEERLALEYAEAASVTPPTVDDALRTRLAAHFDAQALTELTALIGLQNLSARFNSAMDIPAQGLCRIPEKRS	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14003
Length:	182 (171)
Sequences:	1902
Seq/Len:	11.12

YNJA
Paralog alert: 0.34 [within 20: 0.02] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
122_A	134_L	4.236	1.00
139_A	144_A	3.419	1.00
88_A	94_S	2.986	1.00
136_T	140_A	2.81	1.00
122_A	131_D	2.507	1.00
143_D	146_A	2.398	1.00
118_E	137_R	2.244	1.00
164_N	169_I	2.204	1.00
119_Y	151_T	2.178	1.00
132_D	136_T	2.146	1.00
124_S	158_N	2.144	1.00
62_V	116_A	2.122	1.00
116_A	142_F	2.115	1.00
69_R	121_E	2.096	1.00
64_S	83_T	2.007	1.00
92_G	96_K	1.976	1.00
66_V	150_L	1.969	1.00
94_S	98_L	1.89	1.00
119_Y	138_L	1.856	1.00
112_E	142_F	1.791	1.00
93_S	96_K	1.751	1.00
110_S	113_E	1.681	1.00
37_I	149_E	1.628	1.00
71_A	161_A	1.621	1.00
62_V	112_E	1.619	1.00
132_D	168_D	1.613	1.00
131_D	134_L	1.582	1.00
116_A	150_L	1.578	1.00
73_M	125_V	1.555	1.00
112_E	146_A	1.537	1.00
70_I	120_A	1.513	1.00
139_A	147_L	1.466	1.00
158_N	162_R	1.458	1.00
63_R	153_L	1.452	1.00
115_L	134_L	1.452	1.00
73_M	121_E	1.435	1.00
65_L	117_L	1.433	1.00
76_C	79_C	1.413	1.00
10_P	13_L	1.402	0.99
155_G	159_L	1.377	0.99
14_R	18_W	1.347	0.99
160_S	164_N	1.327	0.99
64_S	86_K	1.322	0.99
134_L	137_R	1.315	0.99
61_V	96_K	1.297	0.99
111_D	137_R	1.284	0.99
126_T	129_T	1.277	0.99
74_C	161_A	1.269	0.99
142_F	150_L	1.261	0.99
11_L	14_R	1.229	0.98
67_S	157_Q	1.228	0.98
157_Q	160_S	1.224	0.98
36_R	144_A	1.214	0.98
40_I	152_A	1.194	0.98
61_V	113_E	1.191	0.98
135_R	139_A	1.175	0.98
66_V	116_A	1.163	0.97
112_E	141_H	1.136	0.97
15_P	18_W	1.128	0.97
123_A	166_A	1.126	0.97
57_P	149_E	1.124	0.97
99_A	108_L	1.122	0.97
78_F	82_I	1.104	0.96
71_A	157_Q	1.096	0.96
65_L	113_E	1.096	0.96
59_D	62_V	1.072	0.95
137_R	140_A	1.069	0.95
48_V	67_S	1.063	0.95
11_L	15_P	1.06	0.95
72_Q	121_E	1.058	0.95
87_V	92_G	1.054	0.95
111_D	114_R	1.05	0.94
145_Q	149_E	1.031	0.94
57_P	145_Q	1.026	0.94
67_S	79_C	1.019	0.93
29_S	78_F	1.014	0.93
138_L	147_L	1.01	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2prrA	12	0.989	100	0.208	Contact Map	0.788
2oyoA	2	0.978	100	0.223	Contact Map	0.764
2pfxA	2	0.978	100	0.227	Contact Map	0.72
3c1lA	12	0.978	100	0.228	Contact Map	0.773
3lvyA	6	0.9725	100	0.232	Contact Map	0.686
2o4dA	1	0.9011	100	0.323	Contact Map	0.754
2gmyA	6	0.8352	100	0.337	Contact Map	0.836
2ouwA	2	0.7088	99.9	0.52	Contact Map	0.677
3bjxA	4	0.7473	99.8	0.552	Contact Map	0.216
4n2xA	6	0.7473	99.8	0.568	Contact Map	0.271

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0154 seconds.