OPENSEQ.org - YNAK - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YNAK - Uncharacterized protein YnaK

UniProt:	P76068	Sequence MSEKLKIVYRPLQELSPYAHNARTHSTEQVAQLVESIKQFGWTNPVLIDEKGEIIAGHGRVMAAEMLKMDSVPVIVLSGLTDEQKQR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14296
Length:	87 (84)
Sequences:	292
Seq/Len:	3.48

YNAK
Paralog alert: 0.22 [within 20: 0.07] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
39_Q	84_Q	3.149	1.00
54_I	61_V	2.831	1.00
46_V	54_I	2.394	1.00
29_Q	59_G	2.038	1.00
10_R	14_E	1.811	0.99
49_D	85_K	1.714	0.99
33_L	59_G	1.671	0.99
46_V	61_V	1.593	0.98
42_W	64_A	1.579	0.98
10_R	52_G	1.523	0.97
50_E	78_S	1.496	0.97
48_I	52_G	1.445	0.96
9_Y	71_S	1.421	0.95
25_H	29_Q	1.415	0.95
25_H	62_M	1.4	0.95
34_V	66_M	1.348	0.93
11_P	14_E	1.328	0.92
81_T	84_Q	1.268	0.90
12_L	72_V	1.245	0.89
57_G	60_R	1.24	0.89
35_E	38_K	1.23	0.88
64_A	73_P	1.216	0.87
44_N	47_L	1.216	0.87
25_H	59_G	1.212	0.87
47_L	56_A	1.209	0.87
36_S	58_H	1.2	0.86
10_R	76_V	1.183	0.85
44_N	56_A	1.162	0.84
8_V	12_L	1.138	0.82
21_N	58_H	1.138	0.82
9_Y	73_P	1.137	0.82
48_I	74_V	1.102	0.79
5_L	9_Y	1.098	0.79
26_S	29_Q	1.093	0.78
6_K	12_L	1.091	0.78
35_E	65_E	1.09	0.78
16_S	70_D	1.073	0.77
43_T	77_L	1.068	0.76
50_E	82_D	1.046	0.74
3_E	6_K	1.042	0.74
80_L	84_Q	1.034	0.73
48_I	55_I	1.03	0.72

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1vz0A	8	0.9885	99.6	0.481	Contact Map	0.665
1xw3A	1	0.9655	99.6	0.483	Contact Map	0.558
1yzsA	1	0.9655	99.6	0.49	Contact Map	0.546
1vk1A	1	0.9885	99.5	0.528	Contact Map	0.43
2hwjA	6	0.954	97.4	0.762	Contact Map	0.433
3mt5A	1	0.4483	21	0.909	Contact Map	0
4akrA	2	1	14	0.916	Contact Map	0.162
4n2xA	6	1	13.9	0.916	Contact Map	0.262
2cvbA	1	0.8966	10.3	0.921	Contact Map	0.111
1w9yA	1	0.7241	10.1	0.921	Contact Map	0.278

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0204 seconds.