OPENSEQ.org - YCFL - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YCFL - Uncharacterized protein YcfL

UniProt:	P75946	Sequence MRKGCFGLVSLVLLLLVGCRSHPEIPVNDEQSLVMESSLLAAGISAEKPFLSTSDIQPSASSTLYNERQEPVTVHYRFYWYDARGLEMHPLERPRSVTIPAHSAVTLYGSANFLGAHKVRLYLYL	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13430
Length:	125 (125)
Sequences:	170
Seq/Len:	1.36

YCFL
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
17_V	70_E	1.718	0.93
74_V	99_I	1.486	0.83
51_L	119_V	1.416	0.79
18_G	46_A	1.39	0.77
1_M	14_L	1.359	0.75
33_L	121_L	1.348	0.74
66_N	71_P	1.347	0.74
24_E	124_Y	1.345	0.74
33_L	56_I	1.337	0.73
74_V	97_V	1.331	0.73
63_T	123_L	1.306	0.71
9_V	15_L	1.293	0.70
40_L	94_P	1.288	0.69
44_I	107_L	1.288	0.69
13_L	97_V	1.276	0.68
52_S	59_S	1.275	0.68
1_M	4_G	1.268	0.68
51_L	109_G	1.244	0.65
16_L	53_T	1.24	0.65
18_G	77_R	1.238	0.65
54_S	57_Q	1.234	0.65
66_N	100_P	1.213	0.63
81_Y	118_K	1.205	0.62
81_Y	86_L	1.197	0.61
15_L	99_I	1.189	0.60
18_G	72_V	1.183	0.60
55_D	113_F	1.182	0.60
53_T	93_R	1.164	0.58
47_E	103_S	1.159	0.57
29_D	103_S	1.145	0.56
51_L	72_V	1.145	0.56
81_Y	122_Y	1.142	0.56
27_V	46_A	1.138	0.55
14_L	18_G	1.135	0.55
28_N	49_P	1.134	0.55
74_V	107_L	1.131	0.55
17_V	99_I	1.124	0.54
1_M	5_C	1.121	0.54
77_R	86_L	1.115	0.53
20_R	38_S	1.115	0.53
19_C	79_Y	1.096	0.51
43_G	68_R	1.092	0.51
106_T	117_H	1.092	0.51
91_L	112_N	1.089	0.50
31_Q	86_L	1.085	0.50
44_I	66_N	1.084	0.50
57_Q	91_L	1.083	0.50
74_V	124_Y	1.075	0.49
53_T	83_A	1.069	0.48
21_S	25_I	1.065	0.48
31_Q	34_V	1.062	0.48
88_M	115_G	1.062	0.48
95_R	108_Y	1.06	0.47
48_K	54_S	1.057	0.47
31_Q	81_Y	1.057	0.47
101_A	124_Y	1.055	0.47
88_M	110_S	1.047	0.46
41_A	47_E	1.043	0.46
7_G	10_S	1.039	0.45
74_V	108_Y	1.037	0.45
47_E	70_E	1.035	0.45
55_D	58_P	1.035	0.45
51_L	61_S	1.034	0.45
27_V	58_P	1.031	0.45
62_S	101_A	1.028	0.44
66_N	102_H	1.025	0.44
9_V	17_V	1.021	0.44
46_A	75_H	1.015	0.43
11_L	17_V	1.012	0.43
100_P	103_S	1.012	0.43
79_Y	120_R	1.007	0.42
71_P	100_P	1.005	0.42
34_V	90_P	1.005	0.42
2_R	14_L	1.004	0.42
122_Y	125_L	1.002	0.42
99_I	104_A	1.002	0.42
20_R	44_I	1.001	0.42

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3o0lA	2	0.856	100	0.242	Contact Map	0.275
4gioA	2	0.816	99.9	0.376	Contact Map	0.247
3q48A	2	0.832	93.6	0.854	Contact Map	0.333
3pmqA	1	0.96	93.3	0.856	Contact Map	0.021
3zbiC	14	0.368	90.8	0.866	Contact Map	0
4djmA	8	0.816	88	0.874	Contact Map	0.327
4fajA	1	0.768	88	0.874	Contact Map	0.009
3ucpA	1	0.944	85.2	0.878	Contact Map	0.109
3isyA	1	0.696	78.3	0.887	Contact Map	0.349
4ay0A	2	0.736	75.1	0.89	Contact Map	0.337

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0271 seconds.