OPENSEQ.org - MLAD - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

MLAD - Probable phospholipid ABC transporter-binding protein MlaD

UniProt:	P64604	Sequence MQTKKNEIWVGIFLLAALLAALFVCLKAANVTSIRTEPTYTLYATFDNIGGLKARSPVSIGGVVVGRVADITLDPKTYLPRVTLEIEQRYNHIPDTSSLSIRTSGLLGEQYLALNVGFEDPELGTAILKDGDTIQDTKSAMVLEDLIGQFLYGSKGDDNKNSGDAPAAAPGNNETTEPVGTTK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12799
Length:	183 (153)
Sequences:	923
Seq/Len:	6.03

MLAD
Paralog alert: 0.07 [within 20: 0.03] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
97_S	114_L	3.543	1.00
41_T	83_T	2.286	1.00
43_Y	133_T	2.266	1.00
70_D	83_T	2.16	1.00
42_L	84_L	2.15	1.00
45_T	81_R	2.109	1.00
65_V	93_I	2.106	1.00
64_V	67_R	2.071	1.00
50_G	140_A	2.06	1.00
95_D	120_D	2.015	1.00
93_I	97_S	1.986	1.00
129_K	132_D	1.779	1.00
78_Y	127_I	1.729	1.00
43_Y	83_T	1.725	1.00
43_Y	81_R	1.685	1.00
102_R	113_A	1.635	1.00
128_L	132_D	1.573	0.99
42_L	130_D	1.556	0.99
99_L	114_L	1.501	0.99
52_L	71_I	1.49	0.99
46_F	101_I	1.485	0.99
8_I	12_I	1.476	0.99
128_L	134_I	1.455	0.99
96_T	117_G	1.433	0.99
74_D	81_R	1.427	0.99
72_T	83_T	1.423	0.98
38_P	88_Q	1.385	0.98
44_A	137_T	1.384	0.98
39_T	85_E	1.352	0.98
68_V	86_I	1.316	0.97
12_I	15_L	1.307	0.97
69_A	85_E	1.296	0.97
100_S	115_N	1.296	0.97
105_G	109_E	1.294	0.97
13_F	24_V	1.277	0.96
81_R	112_L	1.263	0.96
52_L	82_V	1.251	0.96
49_I	52_L	1.229	0.95
99_L	112_L	1.195	0.94
15_L	83_T	1.182	0.94
72_T	81_R	1.156	0.93
110_Q	144_E	1.153	0.93
128_L	140_A	1.153	0.93
95_D	132_D	1.145	0.92
45_T	79_L	1.143	0.92
114_L	154_S	1.142	0.92
47_D	139_S	1.135	0.92
42_L	128_L	1.133	0.92
154_S	157_D	1.121	0.91
59_S	111_Y	1.119	0.91
19_L	22_L	1.115	0.91
1_M	154_S	1.113	0.91
56_S	68_V	1.112	0.91
52_L	56_S	1.108	0.91
112_L	135_Q	1.103	0.90
61_G	99_L	1.091	0.90
69_A	83_T	1.088	0.90
35_R	156_G	1.082	0.89
41_T	130_D	1.082	0.89
46_F	134_I	1.068	0.88
49_I	71_I	1.064	0.88
44_A	84_L	1.06	0.88
65_V	114_L	1.056	0.88
9_W	110_Q	1.048	0.87
59_S	64_V	1.041	0.87
86_I	90_Y	1.041	0.87
44_A	141_M	1.037	0.86
25_C	107_L	1.031	0.86
60_I	65_V	1.018	0.85
60_I	73_L	1.017	0.85
117_G	144_E	1	0.84

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
1lplA	1	0.4918	8.4	0.951	Contact Map	0.309
2lx0A	1	0.1694	6.4	0.954	Contact Map	0.396
2mc7A	1	0.1639	4.5	0.957	Contact Map	0.613
2akkA	1	0.3224	4.3	0.957	Contact Map	0.396
4b6mA	2	0.4426	3.7	0.959	Contact Map	0.418
1by6A	1	0.1913	3.2	0.96	Contact Map	0.077
2k0qA	1	0.3661	2.5	0.962	Contact Map	0.286
1eg1A	2	0.3716	2.5	0.962	Contact Map	0.069
2e3iA	1	0.4645	2.3	0.963	Contact Map	0.395
1pfiA	2	0.153	2.2	0.963	Contact Map	0.733

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0728 seconds.