OPENSEQ.org - MLAB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

MLAB - Probable phospholipid ABC transporter-binding protein MlaB

UniProt:	P64602	Sequence MSESLSWMQTGDTLALSGELDQDVLLPLWEMREEAVKGITCIDLSRVSRVDTGGLALLLHLIDLAKKQGNNVTLQGVNDKVYTLAKLYNLPADVLPR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12797
Length:	97 (97)
Sequences:	179
Seq/Len:	1.85

MLAB
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
57_L	90_L	2.686	1.00
85_A	95_L	2.255	1.00
60_H	89_N	1.871	0.98
28_L	57_L	1.822	0.97
19_E	93_D	1.583	0.93
35_A	52_T	1.562	0.92
49_R	89_N	1.525	0.91
53_G	78_N	1.502	0.90
84_L	87_L	1.444	0.87
3_E	8_M	1.34	0.82
38_G	52_T	1.32	0.80
12_D	47_V	1.316	0.80
83_T	87_L	1.303	0.79
29_W	32_R	1.3	0.79
29_W	61_L	1.299	0.79
15_A	46_R	1.295	0.78
17_S	68_Q	1.278	0.77
36_V	52_T	1.266	0.76
60_H	86_K	1.225	0.73
61_L	95_L	1.211	0.72
12_D	15_A	1.209	0.71
9_Q	38_G	1.2	0.71
29_W	87_L	1.198	0.70
60_H	87_L	1.176	0.68
28_L	90_L	1.176	0.68
47_V	92_A	1.176	0.68
49_R	53_G	1.158	0.67
27_P	57_L	1.157	0.67
30_E	46_R	1.155	0.66
23_D	77_V	1.135	0.64
76_G	80_K	1.128	0.64
22_Q	26_L	1.128	0.64
33_E	95_L	1.119	0.63
2_S	23_D	1.118	0.63
52_T	91_P	1.113	0.62
65_A	72_V	1.083	0.59
22_Q	31_M	1.08	0.59
8_M	17_S	1.074	0.58
49_R	60_H	1.069	0.57
66_K	74_L	1.05	0.55
53_G	62_I	1.049	0.55
59_L	88_Y	1.046	0.55
78_N	85_A	1.041	0.54
61_L	87_L	1.034	0.54
7_W	32_R	1.013	0.51
63_D	89_N	1.009	0.51
2_S	96_P	1.006	0.51

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1th8B	1	0.9897	99.1	0.598	Contact Map	0.192
1sboA	1	0.9897	99.1	0.601	Contact Map	0.154
4hylA	2	0.9897	99.1	0.601	Contact Map	0.154
1h4xA	2	0.9691	99	0.62	Contact Map	0.215
2ka5A	1	0.9897	99	0.62	Contact Map	0.145
3t6oA	3	0.9794	99	0.623	Contact Map	0.177
3zxnA	2	0.9897	98.9	0.628	Contact Map	0.175
3oizA	1	0.9485	98.9	0.63	Contact Map	0.206
2klnA	1	0.9897	98.9	0.631	Contact Map	0.104
4dghA	2	0.9897	98.9	0.631	Contact Map	0.128

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0559 seconds.