OPENSEQ.org - YQJE - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YQJE - Inner membrane protein YqjE

UniProt:	P64585	Sequence MADTHHAQGPGKSVLGIGQRIVSIMVEMVETRLRLAVVELEEEKANLFQLLLMLGLTMLFAAFGLMSLMVLIIWAVDPQYRLNAMIATTVVLLLLALIGGIWTLRKSRKSTLLRHTRHELANDRQLLEEESREQ	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12744
Length:	134 (132)
Sequences:	157
Seq/Len:	1.19

YQJE
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
58_M	69_M	1.878	0.95
73_I	119_E	1.72	0.91
64_G	93_L	1.573	0.85
72_I	125_Q	1.544	0.84
87_A	91_V	1.465	0.79
86_I	90_V	1.452	0.78
72_I	90_V	1.379	0.73
4_T	129_E	1.295	0.66
87_A	107_S	1.286	0.65
36_A	113_L	1.278	0.64
4_T	7_A	1.277	0.64
3_D	132_R	1.274	0.64
57_T	103_T	1.267	0.63
5_H	131_S	1.26	0.63
6_H	131_S	1.252	0.62
7_A	130_E	1.244	0.61
96_A	100_G	1.238	0.61
119_E	122_N	1.238	0.61
80_Y	83_N	1.234	0.60
5_H	132_R	1.233	0.60
2_A	130_E	1.215	0.59
71_L	80_Y	1.196	0.57
26_V	127_L	1.195	0.57
2_A	7_A	1.192	0.56
22_V	118_H	1.19	0.56
36_A	116_T	1.19	0.56
51_L	82_L	1.184	0.56
5_H	130_E	1.179	0.55
44_K	81_R	1.179	0.55
90_V	114_R	1.178	0.55
83_N	87_A	1.17	0.54
31_T	105_R	1.164	0.54
40_L	61_A	1.162	0.54
3_D	6_H	1.155	0.53
3_D	7_A	1.15	0.52
36_A	96_A	1.144	0.52
52_L	65_L	1.136	0.51
97_L	108_R	1.136	0.51
17_I	58_M	1.133	0.51
28_M	112_L	1.131	0.51
4_T	132_R	1.128	0.50
21_I	89_T	1.128	0.50
3_D	131_S	1.127	0.50
105_R	125_Q	1.12	0.49
5_H	94_L	1.118	0.49
30_E	103_T	1.116	0.49
18_G	60_F	1.115	0.49
26_V	84_A	1.112	0.49
75_A	121_A	1.109	0.48
33_L	36_A	1.108	0.48
55_G	80_Y	1.103	0.48
23_S	98_I	1.095	0.47
28_M	38_V	1.078	0.45
25_M	76_V	1.075	0.45
12_K	21_I	1.075	0.45
34_R	41_E	1.071	0.45
25_M	38_V	1.063	0.44
2_A	132_R	1.063	0.44
50_L	58_M	1.055	0.43
82_L	124_R	1.053	0.43
43_E	62_A	1.048	0.43
54_L	97_L	1.042	0.42
79_Q	119_E	1.039	0.42
2_A	5_H	1.037	0.42
4_T	131_S	1.035	0.41
40_L	78_P	1.034	0.41
71_L	108_R	1.028	0.41
6_H	132_R	1.016	0.40
68_L	121_A	1.014	0.39
83_N	86_I	1.013	0.39
111_T	116_T	1.011	0.39
16_G	53_M	1.01	0.39
44_K	89_T	1.007	0.39
96_A	113_L	1.005	0.39
54_L	58_M	1.003	0.38
67_S	100_G	1	0.38

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
4hkrA	2	0.8209	15.9	0.932	Contact Map	0.134
4bw5A	4	0.4776	9.3	0.939	Contact Map	0.726
3ukmA	4	0.4478	3.6	0.949	Contact Map	0.661
2kluA	1	0.3881	3	0.951	Contact Map	0.003
3ar4A	1	0.9104	2.6	0.953	Contact Map	0.047
2pqrC	2	0.2388	2.5	0.953	Contact Map	0.132
3j01B	1	0.5597	2.4	0.954	Contact Map	0.064
2f95B	1	0.7687	2	0.956	Contact Map	0.134
1jsuC	1	0.2463	1.9	0.956	Contact Map	0.579
4i5sA	2	0.6418	1.8	0.957	Contact Map	0.112

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.