OPENSEQ.org - YDHL - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YDHL - Uncharacterized protein YdhL

UniProt:	P64474	Sequence MAEQLEFFPVQSPCRGICQSDERGFCRGCFRSRDERFNWNKMSDGEKQEVLRLCRQRLMRKLRANKPASSDEPEQPSLF	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13946
Length:	79 (79)
Sequences:	139
Seq/Len:	1.76

YDHL
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
44_D	47_K	2.708	1.00
42_M	50_V	1.989	0.99
30_F	61_K	1.85	0.97
37_F	53_L	1.692	0.95
68_A	72_E	1.673	0.95
4_Q	8_F	1.63	0.93
24_G	33_R	1.629	0.93
33_R	36_R	1.588	0.92
49_E	52_R	1.488	0.89
75_Q	78_L	1.435	0.86
46_E	49_E	1.428	0.86
69_S	72_E	1.421	0.85
8_F	36_R	1.357	0.82
37_F	56_Q	1.339	0.80
37_F	60_R	1.337	0.80
8_F	33_R	1.313	0.78
46_E	50_V	1.308	0.78
68_A	74_E	1.305	0.78
3_E	10_V	1.293	0.77
8_F	24_G	1.246	0.73
71_D	77_S	1.245	0.73
65_N	68_A	1.244	0.73
21_D	61_K	1.244	0.73
4_Q	36_R	1.231	0.72
75_Q	79_F	1.213	0.70
21_D	66_K	1.209	0.70
10_V	20_S	1.208	0.70
4_Q	33_R	1.201	0.69
7_F	12_S	1.187	0.68
55_R	59_M	1.156	0.65
19_Q	47_K	1.107	0.60
2_A	27_R	1.102	0.59
24_G	36_R	1.1	0.59
21_D	30_F	1.078	0.57
4_Q	24_G	1.063	0.55
34_D	40_N	1.061	0.55
67_P	72_E	1.049	0.54
23_R	47_K	1.033	0.52
5_L	19_Q	1.018	0.50
67_P	71_D	1.016	0.50
64_A	67_P	1.011	0.50
22_E	30_F	1.003	0.49
61_K	71_D	1.001	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
3sc0A	1	0.6835	6.1	0.933	Contact Map	0.125
1r5qA	1	0.4937	3.5	0.94	Contact Map	0.195
2c7nA	6	0.8228	3.3	0.941	Contact Map	0.196
1v2zA	1	0.5823	2.8	0.943	Contact Map	0.289
3etfA	4	0.9873	2.7	0.944	Contact Map	0.534
3uitA	4	0.5063	2.6	0.944	Contact Map	0.257
3mshA	1	0.8734	2.4	0.945	Contact Map	0.079
2o4aA	1	0.6962	2.2	0.946	Contact Map	0.691
3oj3I	8	0.4684	2.1	0.947	Contact Map	0.169
2xppA	1	0.4557	1.5	0.951	Contact Map	0.688

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0362 seconds.