OPENSEQ.org - CBPM - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

CBPM - Chaperone modulatory protein CbpM

UniProt:	P63264	Sequence MANVTVTFTITEFCLHTGISEEELNEIVGLGVVEPREIQETTWVFDDHAAIVVQRAVRLRHELALDWPGIAVALTLMDDIAHLKQENRLLRQRLSRFVAHP	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12194
Length:	101 (100)
Sequences:	153
Seq/Len:	1.53

CBPM
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
56_A	70_I	2.319	0.99
63_L	69_G	1.737	0.95
86_E	90_L	1.692	0.93
14_C	63_L	1.617	0.91
35_P	63_L	1.539	0.88
14_C	35_P	1.472	0.85
80_I	84_K	1.436	0.83
37_E	40_E	1.419	0.82
56_A	74_L	1.404	0.81
36_R	72_V	1.387	0.80
66_D	69_G	1.385	0.80
79_D	92_Q	1.372	0.79
69_G	73_A	1.352	0.78
12_E	15_L	1.312	0.75
37_E	72_V	1.3	0.74
24_L	33_V	1.291	0.73
46_D	49_A	1.29	0.73
18_G	58_R	1.246	0.69
16_H	53_V	1.243	0.69
69_G	74_L	1.238	0.68
27_I	67_W	1.226	0.67
2_A	99_A	1.207	0.66
27_I	60_R	1.185	0.63
22_E	28_V	1.18	0.63
50_A	80_I	1.179	0.63
22_E	88_R	1.17	0.62
3_N	95_S	1.169	0.62
14_C	69_G	1.168	0.62
86_E	91_R	1.163	0.61
55_R	65_L	1.152	0.60
17_T	52_V	1.152	0.60
37_E	44_V	1.126	0.58
27_I	32_V	1.123	0.57
39_Q	51_I	1.11	0.56
67_W	87_N	1.105	0.55
8_F	53_V	1.081	0.53
9_T	81_A	1.077	0.53
87_N	96_R	1.075	0.52
25_N	81_A	1.072	0.52
27_I	68_P	1.07	0.52
14_C	65_L	1.061	0.51
9_T	80_I	1.055	0.50
8_F	54_Q	1.05	0.50
28_V	43_W	1.05	0.50
27_I	69_G	1.038	0.49
30_L	53_V	1.037	0.48
33_V	53_V	1.028	0.47
1_M	5_T	1.022	0.47
50_A	57_V	1.022	0.47
27_I	55_R	1.017	0.46
14_C	55_R	1.014	0.46
32_V	38_I	1.014	0.46
52_V	95_S	1.001	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3ucsA	2	1	99.5	0.575	Contact Map	0.268
1r8dA	2	0.9406	97.9	0.76	Contact Map	0.319
2vz4A	1	0.9307	97.8	0.766	Contact Map	0.283
3gpvA	2	0.9901	97.7	0.771	Contact Map	0.295
2zhgA	1	0.9901	97.6	0.775	Contact Map	0.262
3gp4A	2	0.9406	97.3	0.786	Contact Map	0.249
3qaoA	1	0.9505	97.2	0.787	Contact Map	0.318
2jmlA	1	0.7822	97.2	0.79	Contact Map	0.301
1q06A	2	0.9208	97.1	0.791	Contact Map	0.287
1r8eA	1	0.9703	97.1	0.791	Contact Map	0.302

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0189 seconds.