OPENSEQ.org - APAG - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

APAG - Protein ApaG

UniProt:	P62672	Sequence MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQLLGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDENGVPFSIDIPVFRLAVPTLIH	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10047
Length:	125 (122)
Sequences:	607
Seq/Len:	4.98

APAG
Paralog alert: 0.04 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
47_G	100_E	2.826	1.00
34_T	81_Q	2.173	1.00
96_Q	115_V	2.126	1.00
49_Y	61_E	2.073	1.00
92_L	119_A	1.931	1.00
8_C	38_L	1.929	1.00
52_I	62_V	1.926	1.00
4_S	125_H	1.897	1.00
10_Q	36_R	1.895	1.00
44_Q	73_L	1.843	1.00
98_H	110_S	1.716	1.00
99_Y	113_I	1.691	0.99
103_D	107_V	1.678	0.99
49_Y	63_Q	1.674	0.99
36_R	79_E	1.622	0.99
73_L	104_E	1.598	0.99
32_T	83_T	1.597	0.99
75_A	78_E	1.554	0.99
21_S	24_N	1.521	0.99
29_F	92_L	1.461	0.98
19_Q	85_G	1.43	0.98
100_E	110_S	1.43	0.98
54_N	88_I	1.41	0.97
74_I	78_E	1.378	0.97
15_Y	22_P	1.376	0.97
7_V	43_V	1.373	0.97
25_E	33_V	1.347	0.96
4_S	124_I	1.345	0.96
28_V	87_I	1.344	0.96
92_L	117_R	1.344	0.96
35_I	78_E	1.317	0.96
43_V	125_H	1.311	0.96
29_F	117_R	1.294	0.95
94_T	115_V	1.224	0.93
45_L	101_M	1.222	0.93
46_L	65_E	1.213	0.93
66_G	99_Y	1.211	0.93
13_S	87_I	1.2	0.92
49_Y	98_H	1.191	0.92
11_V	33_V	1.174	0.91
7_V	101_M	1.156	0.90
42_P	74_I	1.144	0.90
10_Q	34_T	1.123	0.88
64_G	95_M	1.121	0.88
53_T	119_A	1.114	0.88
53_T	90_T	1.098	0.87
44_Q	71_Q	1.085	0.86
74_I	80_Y	1.075	0.85
9_I	103_D	1.073	0.85
29_F	94_T	1.06	0.84
75_A	104_E	1.059	0.84
14_V	81_Q	1.049	0.83
29_F	119_A	1.045	0.83
43_V	101_M	1.042	0.83
29_F	114_P	1.037	0.82
12_Q	34_T	1.035	0.82
94_T	120_V	1.034	0.82
13_S	92_L	1.033	0.82
44_Q	102_I	1.031	0.82
42_P	73_L	1.028	0.82
100_E	108_P	1.023	0.81
60_T	89_E	1.018	0.81
63_Q	98_H	1.016	0.80
8_C	36_R	1.011	0.80
41_A	105_N	1.004	0.79

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1xvsA	2	1	100	0.04	Contact Map	0.688
2f1eA	1	1	100	0.042	Contact Map	0.531
1tzaA	2	1	100	0.046	Contact Map	0.644
1xq4A	4	0.992	100	0.056	Contact Map	0.601
3nrfA	2	0.848	67.7	0.916	Contact Map	0.334
3cfuA	2	0.88	35.7	0.931	Contact Map	0.397
1cuoA	1	0.784	31.2	0.933	Contact Map	0.343
2iaaC	1	0.768	28.3	0.934	Contact Map	0.34
2ccwA	1	0.776	26.9	0.935	Contact Map	0.314
3ay2A	2	0.784	21.6	0.938	Contact Map	0.318

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0204 seconds.