OPENSEQ.org - LUXS - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

LUXS - S-ribosylhomocysteine lyase

UniProt:	P45578	Sequence MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12712
Length:	171 (168)
Sequences:	415
Seq/Len:	2.47

LUXS
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
67_H	106_A	2.687	1.00
144_R	148_E	2.297	1.00
84_R	133_M	2.179	1.00
50_E	133_M	2.088	1.00
21_V	34_T	2.08	1.00
162_P	165_K	2.052	1.00
46_E	149_R	2.009	0.99
67_H	110_D	1.987	0.99
105_K	147_L	1.919	0.99
42_V	45_K	1.907	0.99
124_N	127_Q	1.771	0.98
165_K	168_E	1.763	0.98
19_V	104_W	1.738	0.98
105_K	109_E	1.625	0.96
52_G	135_S	1.603	0.96
56_L	143_A	1.596	0.96
48_M	53_I	1.593	0.96
109_E	113_K	1.562	0.95
164_E	167_Q	1.544	0.95
81_M	88_Y	1.532	0.95
48_M	142_I	1.513	0.94
89_M	100_V	1.508	0.94
50_E	84_R	1.463	0.93
64_M	89_M	1.445	0.92
68_L	103_A	1.427	0.91
96_D	99_R	1.416	0.91
116_D	119_Q	1.4	0.90
56_L	111_V	1.388	0.90
145_S	149_R	1.351	0.88
46_E	145_S	1.34	0.88
41_C	142_I	1.338	0.88
162_P	168_E	1.336	0.87
22_A	79_S	1.319	0.87
45_K	147_L	1.315	0.86
32_A	94_T	1.307	0.86
52_G	138_E	1.298	0.85
78_I	87_F	1.253	0.82
160_A	165_K	1.231	0.81
38_L	146_I	1.213	0.80
33_I	143_A	1.2	0.79
164_E	168_E	1.2	0.79
115_Q	165_K	1.169	0.76
45_K	125_V	1.154	0.75
115_Q	140_Q	1.151	0.74
22_A	81_M	1.13	0.72
22_A	88_Y	1.13	0.72
116_D	140_Q	1.122	0.72
17_P	20_R	1.116	0.71
51_R	133_M	1.114	0.71
100_V	103_A	1.112	0.71
27_T	30_G	1.111	0.71
60_F	78_I	1.111	0.71
35_V	88_Y	1.106	0.70
35_V	81_M	1.106	0.70
14_M	42_V	1.104	0.70
72_G	99_R	1.101	0.70
75_I	89_M	1.081	0.68
91_L	100_V	1.072	0.67
26_N	32_A	1.065	0.66
141_D	144_R	1.065	0.66
155_S	158_E	1.062	0.66
16_A	20_R	1.061	0.65
115_Q	119_Q	1.054	0.65
137_Q	144_R	1.05	0.64
24_T	32_A	1.048	0.64
163_K	167_Q	1.048	0.64
115_Q	167_Q	1.036	0.63
22_A	35_V	1.022	0.61
113_K	168_E	1.02	0.61
42_V	115_Q	1.006	0.59
98_Q	153_I	1.005	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1j6wA	2	1	100	0.027	Contact Map	0.631
1vjeA	2	0.9532	100	0.089	Contact Map	0.756
1j98A	1	0.8889	100	0.105	Contact Map	0.699
1j6xA	2	0.9123	100	0.115	Contact Map	0.751
3iixA	1	0.6901	16	0.962	Contact Map	0.125
3otdA	2	0.9298	9.9	0.965	Contact Map	0.121
4ka7A	1	0.5029	8.1	0.966	Contact Map	0.351
2q7aA	2	0.4386	7.9	0.966	Contact Map	0.244
1o7dC	1	0.4094	7.6	0.967	Contact Map	0.224
1qf6A	1	0.7895	6.8	0.967	Contact Map	0.189

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0538 seconds.