OPENSEQ.org - NUDL - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

NUDL - Uncharacterized Nudix hydrolase NudL

UniProt:	P43337	Sequence MEYRSLTLDDFLSRFQLLRPQINRETLNHRQAAVLIPIVRRPQPGLLLTQRSIHLRKHAGQVAFPGGAVDDTDASAIAAALREAEEEVAIPPSAVEVIGVLPPVDSVTGYQVTPVVGIIPPDLPYRASEDEVSAVFEMPLAQALHLGRYHPLDIYRRGDSHRVWLSWYEQYFVWGMTAGIIRELALQIGVKP	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12693
Length:	192 (184)
Sequences:	1271
Seq/Len:	6.91

NUDL
Paralog alert: 0.05 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
69_V	79_A	5.667	1.00
48_L	181_I	3.157	1.00
95_V	117_G	2.965	1.00
85_E	92_P	2.717	1.00
77_I	115_V	2.68	1.00
46_L	181_I	2.471	1.00
84_A	95_V	2.278	1.00
77_I	100_V	2.21	1.00
49_T	63_A	2.15	1.00
35_L	84_A	2.142	1.00
112_V	176_M	2.122	1.00
45_G	137_E	2.114	1.00
74_A	78_A	2.104	1.00
134_A	171_Y	2.051	1.00
35_L	117_G	2.04	1.00
127_A	135_V	2.039	1.00
36_I	180_I	1.987	1.00
78_A	92_P	1.936	1.00
84_A	90_I	1.876	1.00
70_D	128_S	1.791	1.00
69_V	76_A	1.692	1.00
100_V	115_V	1.677	1.00
58_H	61_Q	1.633	1.00
62_V	136_F	1.631	1.00
73_D	78_A	1.601	1.00
75_S	78_A	1.568	1.00
73_D	79_A	1.524	0.99
168_Y	173_V	1.522	0.99
106_S	176_M	1.52	0.99
76_A	79_A	1.52	0.99
136_F	171_Y	1.517	0.99
77_I	97_V	1.493	0.99
53_I	133_S	1.461	0.99
49_T	58_H	1.458	0.99
50_Q	134_A	1.457	0.99
47_L	88_V	1.45	0.99
68_A	110_Y	1.445	0.99
102_P	183_E	1.442	0.99
97_V	117_G	1.404	0.99
54_H	130_D	1.402	0.99
144_L	185_A	1.393	0.99
139_P	142_Q	1.385	0.99
61_Q	110_Y	1.381	0.99
176_M	180_I	1.334	0.98
96_E	120_P	1.302	0.98
104_V	179_G	1.282	0.97
92_P	117_G	1.27	0.97
11_F	15_F	1.256	0.97
41_R	137_E	1.241	0.97
41_R	44_P	1.232	0.96
165_L	172_F	1.23	0.96
108_T	176_M	1.214	0.96
48_L	177_T	1.196	0.96
142_Q	173_V	1.182	0.95
89_A	127_A	1.176	0.95
49_T	55_L	1.167	0.95
50_Q	133_S	1.167	0.95
50_Q	53_I	1.165	0.95
151_P	162_R	1.148	0.94
41_R	45_G	1.146	0.94
139_P	168_Y	1.125	0.93
9_D	13_S	1.118	0.93
37_P	119_I	1.117	0.93
84_A	115_V	1.112	0.93
106_S	110_Y	1.09	0.92
64_F	180_I	1.09	0.92
44_P	141_A	1.08	0.91
19_R	22_I	1.063	0.90
39_V	45_G	1.051	0.90
103_P	111_Q	1.046	0.89
75_S	79_A	1.043	0.89
37_P	117_G	1.042	0.89
143_A	185_A	1.04	0.89
37_P	65_P	1.03	0.88
72_T	78_A	1.021	0.88
149_Y	182_R	1.02	0.88
62_V	173_V	1.013	0.87
166_S	185_A	1.003	0.87
99_G	116_V	1.003	0.87
12_L	16_Q	1	0.86

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1nqzA	1	0.974	99.9	0.531	Contact Map	0.744
3h95A	1	0.9167	99.8	0.656	Contact Map	0.381
3shdA	12	0.7604	99.7	0.689	Contact Map	0.508
3kvhA	1	0.8229	99.6	0.698	Contact Map	0.308
3qsjA	1	0.849	99.6	0.699	Contact Map	0.462
1u20A	2	0.901	99.6	0.702	Contact Map	0.305
3fjyA	2	0.9167	99.6	0.706	Contact Map	0.46
2w4eA	2	0.7448	99.6	0.711	Contact Map	0.465
2xsqA	1	0.8906	99.6	0.711	Contact Map	0.421
1vhzA	2	0.8594	99.5	0.717	Contact Map	0.427

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0457 seconds.