OPENSEQ.org - KPTA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

KPTA - RNA 2'-phosphotransferase

UniProt:	P39380	Sequence MAKYNEKELADTSKFLSFVLRHKPEAIGIVLDREGWADIDKLILCAQKAGKRLTRALLDTVVATSDKKRFSYSSDGRCIRAVQGHSTSQVAISFAEKTPPQFLYHGTASRFLDEIKKQGLIAGERHYVHLSADEATARKVGARHGSPVILTVKAQEMAKRGLPFWQAENGVWLTSTVAVEFLEW	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12570
Length:	184 (180)
Sequences:	527
Seq/Len:	2.93

KPTA
Paralog alert: 0.04 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
160_R	181_F	4.515	1.00
71_S	82_V	3.2	1.00
39_I	58_L	2.934	1.00
39_I	72_Y	2.532	1.00
9_L	60_T	2.433	1.00
174_T	177_V	2.206	1.00
31_L	37_A	2.196	1.00
18_F	23_K	2.136	1.00
55_R	59_D	2.088	1.00
108_A	144_H	1.952	0.99
65_S	68_K	1.94	0.99
103_L	130_L	1.934	0.99
152_V	182_L	1.901	0.99
82_V	167_A	1.774	0.99
150_L	182_L	1.737	0.99
83_Q	169_N	1.721	0.98
94_F	167_A	1.714	0.98
60_T	64_T	1.703	0.98
54_T	57_L	1.696	0.98
118_Q	121_I	1.691	0.98
155_Q	159_K	1.673	0.98
108_A	111_F	1.617	0.97
157_M	164_F	1.616	0.97
61_V	70_F	1.53	0.96
160_R	180_E	1.529	0.96
18_F	26_A	1.485	0.95
153_K	156_E	1.478	0.95
13_S	70_F	1.449	0.94
61_V	65_S	1.443	0.94
19_V	27_I	1.429	0.94
37_A	42_L	1.421	0.93
65_S	70_F	1.419	0.93
71_S	168_E	1.409	0.93
13_S	17_S	1.386	0.92
10_A	14_K	1.383	0.92
68_K	82_V	1.365	0.92
105_H	125_R	1.352	0.91
120_L	176_T	1.34	0.90
101_Q	155_Q	1.338	0.90
99_P	172_W	1.337	0.90
103_L	172_W	1.321	0.90
162_L	178_A	1.3	0.89
153_K	183_E	1.295	0.88
59_D	72_Y	1.288	0.88
131_S	149_I	1.281	0.88
120_L	141_G	1.266	0.87
152_V	164_F	1.244	0.86
151_T	183_E	1.238	0.85
120_L	149_I	1.199	0.83
62_V	83_Q	1.195	0.82
23_K	26_A	1.191	0.82
108_A	130_L	1.19	0.82
164_F	172_W	1.17	0.80
57_L	60_T	1.165	0.80
63_A	68_K	1.155	0.79
73_S	77_R	1.145	0.78
39_I	55_R	1.131	0.77
105_H	143_R	1.125	0.77
16_L	42_L	1.117	0.76
86_S	124_E	1.111	0.75
148_V	175_S	1.111	0.75
62_V	65_S	1.096	0.74
154_A	158_A	1.074	0.72
163_P	175_S	1.071	0.72
5_N	8_E	1.066	0.71
18_F	29_I	1.059	0.70
92_I	127_Y	1.059	0.70
156_E	160_R	1.052	0.70
100_P	172_W	1.048	0.69
96_E	163_P	1.042	0.69
38_D	41_K	1.041	0.68
92_I	130_L	1.038	0.68
64_T	95_A	1.034	0.68
62_V	169_N	1.028	0.67
73_S	76_G	1.021	0.66
83_Q	167_A	1.012	0.65
114_E	118_Q	1.008	0.65
130_L	152_V	1.006	0.65
82_V	168_E	1.006	0.65
130_L	174_T	1.005	0.64
125_R	143_R	1	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1wfxA	1	0.9457	100	0.076	Contact Map	0.635
3hkvA	2	0.8424	82.7	0.93	Contact Map	0.28
2pqfA	6	0.8261	80.8	0.932	Contact Map	0.311
3smjA	2	0.8043	75.2	0.935	Contact Map	0.325
2cqkA	1	0.4511	74.4	0.936	Contact Map	0.544
3bljA	2	0.8859	73.7	0.936	Contact Map	0.316
3kjdA	2	0.837	71.9	0.937	Contact Map	0.412
1efyA	1	0.8315	71.4	0.937	Contact Map	0.327
4dqyC	2	0.8315	71	0.937	Contact Map	0.32
1s29A	1	0.4565	65.2	0.94	Contact Map	0.762

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0443 seconds.