OPENSEQ.org - YIAM - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YIAM - 2,3-diketo-L-gulonate TRAP transporter small permease protein YiaM

UniProt:	P37674	Sequence MKKILEAILAINLAVLSCIVFINIILRYGFQTSILSVDELSRYLFVWLTFIGAIVAFMDNAHVQVTFLVEKLSPAWQRRVALVTHSLILFICGALAWGATLKTIQDWSDYSPILGLPIGLMYAACLPTSLVIAFFELRHLYQLITRSNSLTSPPQGA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12281
Length:	157 (145)
Sequences:	2953
Seq/Len:	20.37

YIAM
Paralog alert: 0.59 [within 20: 0.06] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
25_I	30_F	3.179	1.00
66_T	70_E	3.085	1.00
73_S	76_W	2.919	1.00
75_A	78_R	2.768	1.00
72_L	76_W	2.622	1.00
56_A	61_A	2.403	1.00
22_I	34_I	2.308	1.00
20_V	41_S	2.296	1.00
25_I	29_G	2.271	1.00
88_I	136_E	1.996	1.00
82_L	140_L	1.989	1.00
89_L	133_A	1.921	1.00
135_F	138_R	1.9	1.00
47_W	124_A	1.884	1.00
100_T	104_I	1.75	1.00
96_A	133_A	1.711	1.00
93_G	133_A	1.691	1.00
99_A	126_L	1.69	1.00
26_L	30_F	1.669	1.00
79_R	83_V	1.667	1.00
92_C	129_S	1.661	1.00
93_G	97_W	1.621	1.00
117_P	120_L	1.604	1.00
103_T	123_A	1.556	1.00
76_W	79_R	1.519	1.00
72_L	80_V	1.505	1.00
107_W	119_G	1.498	1.00
111_S	118_I	1.494	1.00
43_Y	118_I	1.463	1.00
92_C	132_I	1.441	1.00
39_E	111_S	1.436	1.00
96_A	130_L	1.436	1.00
43_Y	111_S	1.429	1.00
22_I	26_L	1.424	1.00
111_S	114_L	1.392	0.99
57_F	132_I	1.359	0.99
83_V	87_L	1.325	0.99
106_D	122_Y	1.322	0.99
75_A	79_R	1.318	0.99
97_W	101_L	1.316	0.99
69_V	81_A	1.3	0.99
82_L	144_I	1.299	0.99
6_E	55_V	1.288	0.99
5_L	135_F	1.253	0.99
74_P	77_Q	1.25	0.99
55_V	59_D	1.245	0.98
123_A	126_L	1.243	0.98
137_L	141_Y	1.235	0.98
99_A	129_S	1.235	0.98
53_A	132_I	1.231	0.98
57_F	136_E	1.223	0.98
63_V	66_T	1.221	0.98
123_A	127_P	1.219	0.98
89_L	140_L	1.192	0.98
23_N	38_D	1.185	0.98
38_D	42_R	1.178	0.98
92_C	133_A	1.172	0.98
118_I	121_M	1.167	0.97
21_F	25_I	1.121	0.97
38_D	41_S	1.103	0.96
16_L	48_L	1.1	0.96
124_A	128_T	1.099	0.96
12_N	44_L	1.091	0.96
139_H	142_Q	1.087	0.96
45_F	49_T	1.086	0.96
24_I	28_Y	1.083	0.96
64_Q	81_A	1.074	0.95
68_L	72_L	1.067	0.95
79_R	82_L	1.065	0.95
40_L	114_L	1.065	0.95
99_A	125_C	1.053	0.95
69_V	80_V	1.044	0.94
128_T	131_V	1.042	0.94
43_Y	121_M	1.004	0.93
7_A	11_I	1	0.92
54_I	128_T	1	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
2kncA	1	0.3121	21.7	0.914	Contact Map	0.71
2l8sA	1	0.2994	12.1	0.923	Contact Map	0.524
2odbB	1	0.2038	11.8	0.924	Contact Map	0.542
2ov2I	8	0.2038	11.6	0.924	Contact Map	0.453
4ev6A	5	0.414	11.4	0.924	Contact Map	0.236
4i0uA	10	0.414	11.3	0.924	Contact Map	0.297
4ainA	3	0.6242	8.9	0.928	Contact Map	0.244
2wswA	1	0.6051	7.7	0.93	Contact Map	0.093
3j1zP	2	0.8153	7.7	0.93	Contact Map	0.121
2qmeI	1	0.2102	5.9	0.934	Contact Map	0

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.015 seconds.