OPENSEQ.org - RPIB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

RPIB - Ribose-5-phosphate isomerase B

UniProt:	P37351	Sequence MKKIAFGCDHVGFILKHEIVAHLVERGVEVIDKGTWSSERTDYPHYASQVALAVAGGEVDGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQRRN	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11827
Length:	149 (146)
Sequences:	1563
Seq/Len:	10.71

RPIB
Paralog alert: 0.34 [within 20: 0.18] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
135_Q	139_E	3.533	1.00
45_H	140_A	3.304	1.00
22_H	122_D	2.85	1.00
17_H	20_V	2.524	1.00
26_R	122_D	2.291	1.00
98_Q	130_E	2.075	1.00
7_G	50_V	2.072	1.00
84_A	106_A	2.056	1.00
5_A	33_K	2.039	1.00
33_K	53_A	1.985	1.00
15_L	117_A	1.971	1.00
20_V	24_V	1.953	1.00
85_V	96_S	1.902	1.00
5_A	59_V	1.787	1.00
18_E	114_L	1.731	1.00
12_G	65_I	1.725	1.00
53_A	58_E	1.72	1.00
90_P	119_M	1.675	1.00
5_A	53_A	1.641	1.00
88_S	92_S	1.634	1.00
21_A	25_E	1.606	1.00
3_K	29_E	1.583	1.00
113_G	116_L	1.582	1.00
21_A	24_V	1.512	1.00
31_I	59_V	1.507	1.00
16_K	32_D	1.502	1.00
94_Q	98_Q	1.481	1.00
48_S	52_L	1.462	1.00
52_L	56_G	1.455	1.00
122_D	126_G	1.454	1.00
14_I	109_S	1.444	1.00
102_T	124_W	1.44	1.00
47_A	72_I	1.435	1.00
64_L	76_A	1.423	1.00
63_I	121_V	1.412	1.00
50_V	62_G	1.388	0.99
55_A	79_F	1.379	0.99
89_E	92_S	1.376	0.99
64_L	72_I	1.375	0.99
64_L	106_A	1.363	0.99
48_S	79_F	1.358	0.99
14_I	38_S	1.35	0.99
67_G	110_R	1.343	0.99
51_A	82_I	1.342	0.99
91_Y	95_L	1.336	0.99
13_F	17_H	1.316	0.99
91_Y	111_V	1.294	0.99
115_E	118_K	1.252	0.99
22_H	118_K	1.247	0.99
123_A	127_A	1.246	0.98
42_D	136_Q	1.245	0.98
22_H	26_R	1.239	0.98
98_Q	127_A	1.234	0.98
96_S	124_W	1.228	0.98
18_E	118_K	1.224	0.98
142_T	145_E	1.214	0.98
73_S	86_V	1.21	0.98
48_S	144_I	1.207	0.98
72_I	106_A	1.194	0.98
19_I	121_V	1.192	0.98
80_A	146_Q	1.19	0.98
94_Q	119_M	1.184	0.98
108_G	111_V	1.164	0.97
84_A	104_V	1.151	0.97
40_R	136_Q	1.149	0.97
11_V	110_R	1.136	0.97
107_F	121_V	1.134	0.97
61_G	124_W	1.134	0.97
66_C	72_I	1.132	0.97
47_A	64_L	1.131	0.97
24_V	30_V	1.129	0.97
5_A	57_G	1.126	0.97
73_S	106_A	1.12	0.96
55_A	82_I	1.111	0.96
107_F	112_V	1.102	0.96
51_A	55_A	1.099	0.96
95_L	98_Q	1.086	0.96
90_P	123_A	1.085	0.96
139_E	143_A	1.079	0.95
26_R	126_G	1.066	0.95
96_S	102_T	1.059	0.95
15_L	114_L	1.044	0.94
91_Y	113_G	1.043	0.94
70_V	85_V	1.041	0.94
61_G	97_R	1.012	0.93
6_F	20_V	1.01	0.93
7_G	33_K	1.01	0.93
63_I	105_L	1.009	0.93
134_H	137_R	1.007	0.93
50_V	64_L	1.007	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2vvrA	6	1	100	0.009	Contact Map	0.8
3s5pA	2	0.9799	100	0.019	Contact Map	0.754
3he8A	2	0.9933	100	0.022	Contact Map	0.812
3k7pA	2	1	100	0.023	Contact Map	0.782
3ph3A	2	1	100	0.023	Contact Map	0.818
4lflB	2	0.9933	100	0.024	Contact Map	0.718
2vvpA	5	1	100	0.026	Contact Map	0.795
1o1xA	1	0.9664	100	0.041	Contact Map	0.796
3sgwA	1	1	100	0.042	Contact Map	0.677
4lflA	2	0.953	100	0.053	Contact Map	0.763

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.5788 seconds.