OPENSEQ.org - FXSA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

FXSA - UPF0716 protein FxsA

UniProt:	P37147	Sequence MRWLPFIAIFLYVYIEISIFIQVAHVLGVLLTLVLVIFTSVIGMSLVRNQGFKNFVLMQQKMAAGENPAAEMIKSVSLIIAGLLLLLPGFFTDFLGLLLLLPPVQKHLTVKLMPHLRFSRMPGGGFSAGTGGGNTFDGEYQRKDDERDRLDHKDDRQD	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12382
Length:	158 (151)
Sequences:	396
Seq/Len:	2.62

FXSA
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
81_A	99_L	2.498	1.00
19_I	91_F	2.119	1.00
15_I	91_F	2.09	1.00
23_V	90_F	1.97	0.99
29_V	33_L	1.846	0.99
39_T	96_G	1.8	0.99
101_L	104_V	1.791	0.99
18_S	29_V	1.706	0.98
95_L	99_L	1.647	0.97
137_D	143_K	1.62	0.97
69_A	86_L	1.614	0.97
146_E	149_R	1.576	0.96
148_D	151_D	1.574	0.96
27_L	90_F	1.549	0.96
68_P	92_T	1.487	0.94
36_V	96_G	1.475	0.94
60_Q	64_A	1.452	0.93
78_L	96_G	1.438	0.93
51_G	85_L	1.388	0.91
32_T	39_T	1.386	0.91
75_S	105_Q	1.359	0.90
50_Q	92_T	1.343	0.89
47_V	82_G	1.325	0.88
23_V	47_V	1.324	0.88
47_V	106_K	1.32	0.88
37_I	41_V	1.308	0.87
6_F	10_F	1.303	0.87
20_F	36_V	1.303	0.87
44_M	79_I	1.296	0.86
59_Q	96_G	1.289	0.86
9_I	36_V	1.286	0.86
42_I	45_S	1.273	0.85
70_A	74_K	1.267	0.85
24_A	29_V	1.26	0.84
99_L	104_V	1.259	0.84
24_A	105_Q	1.248	0.83
82_G	93_D	1.233	0.82
6_F	87_L	1.22	0.81
35_L	51_G	1.218	0.81
13_V	24_A	1.214	0.81
36_V	39_T	1.21	0.81
74_K	109_T	1.206	0.80
83_L	87_L	1.205	0.80
28_G	90_F	1.194	0.80
92_T	101_L	1.186	0.79
107_H	111_K	1.176	0.78
37_I	52_F	1.172	0.78
38_F	114_P	1.144	0.75
134_N	139_E	1.141	0.75
77_S	108_L	1.124	0.74
50_Q	100_L	1.117	0.73
22_Q	25_H	1.108	0.72
39_T	92_T	1.098	0.71
123_G	133_G	1.081	0.69
41_V	44_M	1.077	0.69
147_R	151_D	1.074	0.69
15_I	18_S	1.074	0.69
106_K	114_P	1.07	0.68
38_F	55_F	1.066	0.68
95_L	111_K	1.063	0.67
20_F	82_G	1.057	0.67
42_I	97_L	1.055	0.67
147_R	150_L	1.041	0.65
37_I	64_A	1.036	0.65
27_L	32_T	1.034	0.64
68_P	75_S	1.032	0.64
87_L	92_T	1.029	0.64
128_A	131_G	1.027	0.64
61_K	71_E	1.02	0.63
31_L	34_V	1.017	0.62
54_N	57_L	1.009	0.62
25_H	30_L	1.008	0.61
38_F	42_I	1	0.60
44_M	86_L	1	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
3w9iA	6	0.7911	10	0.944	Contact Map	0.234
4dx5A	3	0.8481	9.5	0.945	Contact Map	0.188
4i0uA	10	0.3354	9.3	0.945	Contact Map	0.484
2m20A	2	0.3418	8.3	0.946	Contact Map	0.201
4ev6A	5	0.3354	7.2	0.948	Contact Map	0.518
3ne5A	1	0.7215	3.6	0.955	Contact Map	0.191
3rkoA	2	0.481	2	0.96	Contact Map	0.391
4he8N	2	0.5886	1.8	0.961	Contact Map	0.157
1iflA	1	0.2595	1.6	0.962	Contact Map	0.11
3aqpA	2	0.7848	1.5	0.963	Contact Map	0.142

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0251 seconds.