OPENSEQ.org - MOBB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

MOBB - Molybdopterin-guanine dinucleotide biosynthesis adapter protein

UniProt:	P32125	Sequence MAGKTMIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDVDKPGKDSYELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQNG	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11828
Length:	175 (165)
Sequences:	698
Seq/Len:	4.23

MOBB
Paralog alert: 0.02 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
25_K	59_E	4.828	1.00
16_S	55_K	3.534	1.00
40_L	60_L	3.41	1.00
34_R	164_D	3.102	1.00
158_D	161_G	2.83	1.00
75_R	81_E	2.755	1.00
14_A	18_T	2.621	1.00
39_G	97_M	2.236	1.00
50_V	79_M	2.225	1.00
39_G	102_L	2.079	1.00
27_L	162_L	2.065	1.00
30_A	160_E	2.058	1.00
36_I	167_V	1.959	1.00
30_A	34_R	1.955	1.00
32_C	66_A	1.92	1.00
118_I	140_A	1.907	1.00
30_A	159_V	1.869	1.00
9_L	94_A	1.776	1.00
61_R	81_E	1.747	0.99
44_T	48_M	1.701	0.99
48_M	72_S	1.66	0.99
67_Q	80_T	1.647	0.99
51_D	54_G	1.614	0.99
58_Y	62_K	1.584	0.99
11_A	115_I	1.54	0.98
24_L	60_L	1.528	0.98
107_V	115_I	1.512	0.98
50_V	77_A	1.502	0.98
30_A	164_D	1.454	0.97
111_K	117_K	1.448	0.97
27_L	163_A	1.442	0.97
23_L	162_L	1.436	0.97
142_A	154_L	1.429	0.97
140_A	154_L	1.381	0.96
69_I	78_L	1.377	0.96
24_L	29_P	1.361	0.95
152_A	165_F	1.345	0.95
51_D	58_Y	1.343	0.95
34_R	163_A	1.332	0.95
11_A	107_V	1.332	0.95
30_A	33_A	1.308	0.94
142_A	156_I	1.29	0.93
18_T	120_L	1.282	0.93
70_V	77_A	1.278	0.93
154_L	165_F	1.276	0.93
28_I	40_L	1.27	0.93
94_A	105_I	1.263	0.93
22_T	159_V	1.258	0.92
17_G	55_K	1.256	0.92
131_E	138_V	1.225	0.91
44_T	60_L	1.223	0.91
142_A	155_D	1.221	0.91
11_A	45_H	1.151	0.87
14_A	68_T	1.142	0.86
47_D	74_Q	1.137	0.86
143_S	146_P	1.135	0.86
34_R	167_V	1.132	0.86
159_V	166_V	1.123	0.85
160_E	164_D	1.123	0.85
30_A	163_A	1.102	0.84
28_I	36_I	1.1	0.84
144_D	157_N	1.086	0.83
44_T	72_S	1.084	0.82
48_M	70_V	1.078	0.82
159_V	162_L	1.068	0.81
118_I	142_A	1.067	0.81
61_R	75_R	1.062	0.81
26_K	157_N	1.046	0.79
12_F	27_L	1.019	0.77
31_L	167_V	1.015	0.76
16_S	24_L	1.007	0.75
14_A	60_L	1.003	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1xjcA	1	0.9486	100	0.417	Contact Map	0.589
1np6A	2	0.9886	99.9	0.591	Contact Map	0.697
2f1rA	2	0.9371	99.7	0.69	Contact Map	0.684
2wsmA	2	0.9029	98.7	0.808	Contact Map	0.432
2hf9A	2	0.9143	98.4	0.822	Contact Map	0.54
4a0gA	4	0.9714	98.3	0.825	Contact Map	0.232
1vcoA	1	0.9943	98.2	0.832	Contact Map	0.486
3fgnA	4	0.9657	98.2	0.833	Contact Map	0.398
3of5A	2	0.92	97.9	0.844	Contact Map	0.445
3qxcA	1	0.9429	97.9	0.845	Contact Map	0.551

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0358 seconds.