OPENSEQ.org - FLIS - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

FLIS - Flagellar protein FliS

UniProt:	P26608	Sequence MYAAKGTQAYAQIGVESAVMSASQQQLVTMLFDGVLSALVRASLFMQDNNQQGKGVSLSKAINIIENGLRVSLDEESKDELTQNLIALYSYMVRRLLQANLRNDVSAVEEVEALMRNIADAWKESLLSPSLIQDPV	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11388
Length:	136 (128)
Sequences:	706
Seq/Len:	5.52

FLIS
Paralog alert: 0.13 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
39_L	108_V	3.692	1.00
95_R	110_E	3.38	1.00
92_M	111_V	3.283	1.00
43_S	109_E	3.231	1.00
70_R	86_I	3.172	1.00
35_V	115_M	3.054	1.00
54_K	103_N	2.827	1.00
50_N	53_G	2.405	1.00
33_D	119_A	2.339	1.00
55_G	59_S	2.303	1.00
95_R	107_A	2.301	1.00
80_E	84_N	2.153	1.00
119_A	123_K	2.104	1.00
31_L	64_I	2.096	1.00
91_Y	110_E	2.004	1.00
74_D	77_S	1.971	1.00
47_Q	105_V	1.922	1.00
90_S	94_R	1.895	1.00
78_K	82_T	1.851	1.00
91_Y	95_R	1.697	1.00
65_I	92_M	1.689	1.00
79_D	82_T	1.687	1.00
44_L	48_D	1.669	1.00
92_M	114_L	1.541	0.99
58_L	108_V	1.51	0.99
34_G	38_A	1.464	0.99
36_L	112_E	1.435	0.98
52_Q	56_V	1.409	0.98
75_E	82_T	1.395	0.98
46_M	54_K	1.343	0.97
110_E	114_L	1.323	0.97
58_L	96_L	1.292	0.96
38_A	60_K	1.282	0.96
104_D	107_A	1.253	0.95
95_R	98_Q	1.239	0.95
92_M	115_M	1.173	0.92
29_T	123_K	1.172	0.92
30_M	64_I	1.167	0.92
25_Q	127_L	1.148	0.91
63_N	67_N	1.147	0.91
28_V	72_S	1.133	0.91
121_A	124_E	1.123	0.90
85_L	118_I	1.12	0.90
56_V	60_K	1.106	0.89
40_V	112_E	1.1	0.89
34_G	64_I	1.097	0.89
46_M	103_N	1.094	0.88
43_S	112_E	1.084	0.88
31_L	34_G	1.081	0.88
53_G	56_V	1.048	0.85
8_Q	11_A	1.047	0.85
88_L	114_L	1.045	0.85
52_Q	55_G	1.042	0.85
45_F	48_D	1.038	0.85
75_E	86_I	1.035	0.84
29_T	119_A	1.014	0.83
36_L	40_V	1.012	0.83
95_R	111_V	1.01	0.82
70_R	90_S	1.008	0.82
55_G	103_N	1.005	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3iqcA	2	0.9265	100	0.115	Contact Map	0.768
1vh6A	2	0.9338	100	0.145	Contact Map	0.834
1orjA	4	0.9191	100	0.151	Contact Map	0.829
3sjrA	4	0.5662	23.9	0.923	Contact Map	0.344
2rklA	6	0.3529	20.8	0.925	Contact Map	0.792
2za4B	2	0.5882	12.5	0.932	Contact Map	0.215
2i9cA	1	0.7721	6.2	0.941	Contact Map	0.196
2b5uA	2	0.9191	5	0.943	Contact Map	0.284
3zilB	1	0.2059	3.8	0.947	Contact Map
2katA	1	0.7721	2.8	0.95	Contact Map	0.333

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.