OPENSEQ.org - HPPK - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

HPPK - 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

UniProt:	P26281	Sequence MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11374
Length:	159 (159)
Sequences:	2112
Seq/Len:	13.28

HPPK
Paralog alert: 0.11 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
39_S	131_E	4.481	1.00
6_I	97_L	3.397	1.00
2_T	103_G	3.317	1.00
81_Q	95_L	2.927	1.00
72_N	111_R	2.868	1.00
118_D	121_N	2.649	1.00
68_E	109_T	2.642	1.00
38_S	57_A	2.566	1.00
74_T	97_L	2.467	1.00
15_P	42_R	2.431	1.00
107_I	114_V	2.213	1.00
41_Y	131_E	2.154	1.00
42_R	53_D	2.11	1.00
75_Q	85_R	2.106	1.00
44_P	53_D	2.07	1.00
46_L	118_D	2.018	1.00
23_L	59_V	1.976	1.00
25_A	80_Q	1.944	1.00
14_S	17_E	1.937	1.00
68_E	111_R	1.881	1.00
142_E	150_T	1.877	1.00
100_M	119_M	1.867	1.00
10_S	18_Q	1.805	1.00
48_P	54_Y	1.799	1.00
8_I	19_V	1.792	1.00
3_V	62_E	1.782	1.00
108_N	113_T	1.698	1.00
48_P	88_E	1.662	1.00
15_P	18_Q	1.62	1.00
5_Y	60_A	1.607	1.00
10_S	15_P	1.599	1.00
143_M	146_Q	1.56	1.00
29_I	73_H	1.552	1.00
4_A	61_L	1.55	1.00
29_I	32_S	1.524	1.00
6_I	74_T	1.523	1.00
3_V	60_A	1.439	1.00
101_L	136_L	1.409	1.00
7_A	100_M	1.387	0.99
63_T	102_F	1.374	0.99
19_V	40_F	1.344	0.99
51_Q	92_P	1.337	0.99
27_G	34_I	1.335	0.99
89_R	118_D	1.334	0.99
119_M	125_M	1.332	0.99
40_F	57_A	1.322	0.99
85_R	94_T	1.315	0.99
35_L	62_E	1.299	0.99
66_A	69_E	1.29	0.99
18_Q	81_Q	1.277	0.99
73_H	76_R	1.269	0.99
12_L	52_P	1.266	0.99
101_L	119_M	1.262	0.99
40_F	55_L	1.261	0.99
51_Q	91_G	1.253	0.99
47_G	90_W	1.239	0.98
88_E	91_G	1.226	0.98
76_R	80_Q	1.201	0.98
123_G	127_W	1.177	0.98
16_L	20_N	1.171	0.98
25_A	81_Q	1.152	0.97
23_L	37_V	1.15	0.97
99_I	114_V	1.148	0.97
120_K	147_I	1.146	0.97
36_T	60_A	1.145	0.97
105_E	114_V	1.14	0.97
49_Q	54_Y	1.139	0.97
88_E	92_P	1.139	0.97
26_L	59_V	1.138	0.97
101_L	114_V	1.09	0.96
36_T	132_I	1.072	0.95
21_A	25_A	1.068	0.95
15_P	52_P	1.067	0.95
21_A	81_Q	1.039	0.94
4_A	63_T	1.02	0.93
81_Q	94_T	1.016	0.93
120_K	140_D	1.01	0.93
20_N	40_F	1.009	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2qx0A	2	1	100	-0.006	Contact Map	0.749
1cbkA	2	0.9937	100	-0.004	Contact Map	0.818
3qbcA	2	0.9811	100	0.009	Contact Map	0.789
1f9yA	1	0.9937	100	0.011	Contact Map	0.876
2cg8A	4	0.9497	100	0.016	Contact Map	0.842
2bmbA	1	0.9937	100	0.027	Contact Map	0.704
3mcmA	2	0.9937	100	0.054	Contact Map	0.782
3zbqA	1	0.6918	60.9	0.923	Contact Map	0.039
3r4vA	1	0.673	31.8	0.935	Contact Map	0.06
1phzA	1	0.8805	19.6	0.942	Contact Map	0.159

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0134 seconds.