OPENSEQ.org - PGPA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PGPA - Phosphatidylglycerophosphatase A

UniProt:	P18200	Sequence MTILPRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAAIPFWYLMTFLPWQLYSLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMALPTNDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIGHHWPLGILS	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10704
Length:	172 (151)
Sequences:	658
Seq/Len:	4.36

PGPA
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
33_S	40_M	4.954	1.00
42_S	98_M	3.467	1.00
79_A	144_I	2.998	1.00
71_G	145_M	2.997	1.00
26_V	89_S	2.652	1.00
122_I	126_W	2.618	1.00
97_G	152_G	2.458	1.00
87_H	90_I	2.32	1.00
27_G	95_F	2.231	1.00
67_G	96_I	2.13	1.00
43_L	117_F	2.046	1.00
101_T	152_G	1.938	1.00
85_H	90_I	1.912	1.00
36_V	125_M	1.852	1.00
98_M	102_L	1.802	1.00
35_I	40_M	1.752	0.99
46_I	98_M	1.671	0.99
134_F	146_I	1.655	0.99
75_C	92_W	1.635	0.99
97_G	101_T	1.606	0.99
76_H	80_K	1.593	0.99
101_T	116_G	1.561	0.99
68_I	96_I	1.561	0.99
119_I	155_S	1.549	0.98
118_V	122_I	1.548	0.98
45_A	98_M	1.545	0.98
75_C	141_G	1.533	0.98
131_I	154_I	1.529	0.98
65_M	69_C	1.528	0.98
100_I	152_G	1.488	0.98
134_F	150_V	1.459	0.97
95_F	99_W	1.444	0.97
132_R	136_R	1.444	0.97
135_D	139_H	1.428	0.97
96_I	149_I	1.395	0.96
63_V	67_G	1.378	0.96
102_L	116_G	1.354	0.96
142_M	146_I	1.346	0.95
43_L	47_P	1.341	0.95
138_V	146_I	1.329	0.95
131_I	134_F	1.314	0.95
79_A	141_G	1.305	0.94
72_V	141_G	1.279	0.93
68_I	145_M	1.275	0.93
78_T	88_G	1.232	0.92
61_S	103_M	1.23	0.92
128_P	131_I	1.226	0.91
68_I	149_I	1.209	0.91
35_I	125_M	1.189	0.90
130_P	133_W	1.188	0.90
30_S	41_G	1.183	0.89
66_L	70_I	1.183	0.89
78_T	89_S	1.176	0.89
57_W	103_M	1.17	0.89
79_A	87_H	1.166	0.88
62_L	137_N	1.161	0.88
27_G	30_S	1.128	0.86
129_W	132_R	1.125	0.86
34_P	40_M	1.097	0.84
19_N	22_H	1.088	0.83
146_I	149_I	1.083	0.83
74_L	92_W	1.063	0.81
68_I	142_M	1.052	0.80
131_I	150_V	1.048	0.80
73_Y	77_Q	1.046	0.80
67_G	99_W	1.045	0.80
42_S	102_L	1.04	0.79
78_T	81_D	1.04	0.79
13_S	16_K	1.039	0.79
76_H	79_A	1.033	0.79
113_V	152_G	1.028	0.78
49_W	102_L	1.02	0.77
65_M	152_G	1.018	0.77
12_K	16_K	1.015	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1y9iA	4	0.9302	99.9	0.581	Contact Map	0.476
1rfzA	4	0.9128	99.9	0.59	Contact Map	0.547
1tlqA	1	0.9244	99.9	0.61	Contact Map	0.471
2lw6A	1	0.2442	1.7	0.97	Contact Map	0
3arcI	2	0.1163	1.4	0.971	Contact Map
2cfqA	1	0.4767	1.4	0.971	Contact Map	0.005
2ksfA	1	0.4709	1.2	0.972	Contact Map	0.454
2la0A	1	0.1744	1.2	0.972	Contact Map	0.068
2k98A	1	0.1395	1.2	0.972	Contact Map	0.43
3pf7A	2	0.3314	1.2	0.973	Contact Map	0.331

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0428 seconds.