OPENSEQ.org - FLIN - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

FLIN - Flagellar motor switch protein FliN

UniProt:	P15070	Sequence MSDMNNPADDNNGAMDDLWAEALSEQKSTSSKSAAETVFQQFGGGDVSGTLQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10324
Length:	137 (136)
Sequences:	201
Seq/Len:	1.48

FLIN
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
19_W	22_A	1.929	0.97
80_R	122_I	1.842	0.96
22_A	26_Q	1.747	0.94
58_M	118_Y	1.734	0.94
72_R	116_D	1.714	0.94
99_I	115_A	1.685	0.93
74_T	104_Y	1.667	0.92
80_R	124_D	1.648	0.92
99_I	122_I	1.626	0.91
28_S	49_G	1.606	0.90
16_D	24_S	1.593	0.90
62_V	98_D	1.55	0.88
80_R	115_A	1.502	0.86
62_V	91_G	1.468	0.84
115_A	124_D	1.457	0.84
80_R	99_I	1.447	0.83
99_I	118_Y	1.436	0.82
36_E	49_G	1.424	0.82
64_L	68_L	1.414	0.81
63_K	122_I	1.409	0.81
97_L	125_I	1.398	0.80
101_I	118_Y	1.391	0.80
57_I	60_I	1.35	0.77
18_L	26_Q	1.346	0.76
77_E	80_R	1.345	0.76
82_T	97_L	1.341	0.76
115_A	122_I	1.334	0.75
108_Q	125_I	1.294	0.72
38_V	136_S	1.291	0.72
91_G	98_D	1.285	0.72
15_M	34_A	1.248	0.68
98_D	106_I	1.245	0.68
54_I	90_D	1.241	0.68
2_S	12_N	1.179	0.62
91_G	127_T	1.175	0.61
4_M	10_D	1.171	0.61
22_A	25_E	1.168	0.61
52_Q	68_L	1.158	0.60
67_E	70_R	1.148	0.59
64_L	104_Y	1.145	0.59
19_W	23_L	1.123	0.56
52_Q	60_I	1.116	0.56
5_N	8_A	1.113	0.55
13_G	30_S	1.112	0.55
77_E	122_I	1.109	0.55
66_V	108_Q	1.106	0.55
71_T	92_L	1.102	0.54
101_I	122_I	1.1	0.54
60_I	95_E	1.093	0.53
4_M	12_N	1.087	0.53
77_E	88_A	1.085	0.52
87_V	124_D	1.083	0.52
70_R	87_V	1.083	0.52
62_V	104_Y	1.078	0.52
97_L	108_Q	1.077	0.52
4_M	9_D	1.054	0.49
132_M	136_S	1.053	0.49
19_W	85_S	1.047	0.49
10_D	13_G	1.047	0.49
4_M	8_A	1.039	0.48
65_T	132_M	1.032	0.47
100_L	117_K	1.032	0.47
66_V	82_T	1.03	0.47
99_I	120_V	1.027	0.46
45_G	49_G	1.026	0.46
81_L	89_L	1.014	0.45
18_L	27_K	1.014	0.45
106_I	111_V	1.014	0.45
19_W	26_Q	1.013	0.45
104_Y	108_Q	1.009	0.45
91_G	108_Q	1.008	0.45
96_P	128_P	1.005	0.44
62_V	134_R	1.005	0.44
5_N	12_N	1.003	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1o6aA	2	0.7007	99.9	0.587	Contact Map	0.154
3uepA	2	0.7007	99.9	0.609	Contact Map	0.122
1o9yA	4	0.6131	99.8	0.623	Contact Map	0.114
3dhaA	1	0.4964	32.2	0.941	Contact Map	0.036
2qveA	2	0.5182	21.5	0.946	Contact Map	0.052
1gkmA	1	0.5255	16	0.949	Contact Map	0.106
3pvvA	2	0.2628	13.3	0.951	Contact Map	0.395
2o6yA	8	0.5766	9.3	0.954	Contact Map	0.092
3rfzB	2	0.5401	7.7	0.956	Contact Map	0.225
3bwuD	1	0.5401	6.9	0.957	Contact Map	0.177

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.011 seconds.