OPENSEQ.org - ISCX - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

ISCX - Protein IscX

UniProt:	P0C0L9	Sequence MGLKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEAE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12311
Length:	66 (66)
Sequences:	215
Seq/Len:	3.26

ISCX
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
36_I	57_I	3.512	1.00
10_E	14_A	3.34	1.00
10_E	13_E	2.678	1.00
34_Q	38_D	2.598	1.00
33_H	49_S	2.088	1.00
4_K	44_D	1.999	1.00
33_H	37_C	1.688	0.99
18_A	40_E	1.603	0.98
31_D	35_W	1.522	0.97
6_T	53_I	1.477	0.96
22_L	35_W	1.363	0.93
19_Y	22_L	1.351	0.92
19_Y	38_D	1.305	0.91
16_Y	47_Q	1.273	0.89
59_L	63_D	1.265	0.89
8_S	60_V	1.25	0.88
13_E	16_Y	1.237	0.87
13_E	17_D	1.226	0.87
18_A	66_E	1.209	0.86
2_G	12_G	1.178	0.83
28_R	31_D	1.178	0.83
9_R	60_V	1.156	0.82
30_T	50_N	1.148	0.81
24_P	27_V	1.089	0.76
12_G	60_V	1.088	0.76
50_N	60_V	1.072	0.75
58_L	62_L	1.071	0.75
3_L	41_D	1.057	0.73
49_S	57_I	1.042	0.72
9_R	13_E	1.023	0.70
33_H	50_N	1.022	0.70
4_K	17_D	1.019	0.69
37_C	49_S	1.008	0.68
32_M	58_L	1.002	0.67
36_I	43_D	1.001	0.67
34_Q	49_S	1	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
1uj8A	1	1	100	0.061	Contact Map	0.54
2kzvA	1	0.9091	42.2	0.894	Contact Map	0.293
3u3lC	1	0.9545	16.2	0.914	Contact Map	0.104
2kpmA	1	1	14.9	0.915	Contact Map	0.321
3ap1A	2	0.8485	8.3	0.924	Contact Map	0.138
1u7kA	6	0.7727	7	0.927	Contact Map	0.409
1wj6A	1	0.697	6.1	0.929	Contact Map	0.427
1xl3C	2	0.9697	5.3	0.931	Contact Map	0.546
4goxA	1	0.8485	5.3	0.931	Contact Map	0.168
2ynmD	1	0.9394	4.9	0.932	Contact Map	0.296

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0697 seconds.