OPENSEQ.org - RELE - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

RELE - mRNA interferase RelE

UniProt:	P0C077	Sequence MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKRERSEVYSEAVKRIL	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11131
Length:	95 (94)
Sequences:	191
Seq/Len:	2.03

RELE
Paralog alert: 0.23 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
38_R	49_D	2.892	1.00
47_M	50_C	2.371	1.00
34_L	73_V	2.206	1.00
5_L	34_L	2.126	0.99
12_L	16_R	1.897	0.98
33_V	42_N	1.849	0.98
27_K	31_V	1.727	0.97
77_S	90_A	1.684	0.96
63_V	90_A	1.635	0.95
50_C	65_Q	1.535	0.92
13_K	25_Q	1.533	0.92
10_R	74_F	1.471	0.90
33_V	39_I	1.429	0.88
23_R	78_V	1.414	0.88
48_P	84_S	1.388	0.86
11_A	15_W	1.333	0.83
6_D	70_K	1.333	0.83
76_I	83_R	1.314	0.82
24_E	69_E	1.302	0.81
7_F	11_A	1.286	0.80
4_F	9_E	1.275	0.79
87_Y	93_R	1.266	0.79
13_K	26_L	1.239	0.77
29_K	32_E	1.219	0.75
11_A	75_V	1.219	0.75
47_M	65_Q	1.215	0.75
83_R	90_A	1.215	0.75
85_E	88_S	1.208	0.74
25_Q	29_K	1.177	0.71
86_V	90_A	1.176	0.71
88_S	91_V	1.169	0.70
40_E	43_K	1.162	0.70
2_A	21_T	1.16	0.70
15_W	27_K	1.147	0.68
50_C	76_I	1.133	0.67
5_L	73_V	1.132	0.67
9_E	50_C	1.088	0.62
38_R	51_Y	1.082	0.62
17_K	25_Q	1.074	0.61
20_S	24_E	1.046	0.58
69_E	72_V	1.044	0.58
70_K	92_K	1.044	0.58
58_S	86_V	1.011	0.54
17_K	84_S	1.01	0.54

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
4fxiA	3	1	99.7	0.591	Contact Map	0.496
3g5oB	2	0.8947	99.4	0.67	Contact Map	0.353
2kheA	1	0.8842	99.3	0.684	Contact Map	0.299
1wmiA	2	0.8842	99.2	0.704	Contact Map	0.37
2otrA	1	0.9579	99.1	0.711	Contact Map	0.295
3oeiC	8	0.8316	99	0.719	Contact Map	0.408
1z8mA	1	0.8526	99	0.719	Contact Map	0.238
3bpqB	2	0.8737	98.8	0.745	Contact Map	0.346
2a6sA	4	0.8105	98.5	0.77	Contact Map	0.47
3kxeA	2	0.8842	96.3	0.846	Contact Map	0.442

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0176 seconds.