OPENSEQ.org - RATA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

RATA - Ribosome association toxin RatA

UniProt:	P0AGL5	Sequence MILFVGFLLMEIVMPQISRTALVPYSAEQMYQLVNDVQSYPQFLPGCTGSRILESTPGQMTAAVDVSKAGISKTFTTRNQLTSNQSILMNLVDGPFKKLIGGWKFTPLSQEACRIEFHLDFEFTNKLIELAFGRVFKELAANMVQAFTVRAKEVYSAR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13193
Length:	158 (144)
Sequences:	704
Seq/Len:	4.89

RATA
Paralog alert: 0.03 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
39_S	42_Q	3.788	1.00
34_V	105_F	2.91	1.00
150_R	154_V	2.735	1.00
36_D	39_S	2.547	1.00
25_Y	152_K	2.503	1.00
38_Q	55_S	2.465	1.00
150_R	153_E	2.444	1.00
82_T	85_Q	2.279	1.00
28_E	32_Q	2.139	1.00
97_K	122_E	2.125	1.00
53_L	63_A	2.11	1.00
26_S	29_Q	2.078	1.00
37_V	60_M	1.956	1.00
51_R	63_A	1.898	1.00
89_M	101_G	1.842	1.00
65_D	74_T	1.73	1.00
106_T	116_E	1.689	0.99
80_Q	88_L	1.588	0.99
49_G	65_D	1.539	0.99
35_N	81_L	1.451	0.98
23_V	30_M	1.425	0.98
16_Q	52_I	1.415	0.97
33_L	151_A	1.387	0.97
63_A	74_T	1.364	0.97
126_K	130_L	1.328	0.96
31_Y	84_N	1.291	0.95
54_E	61_T	1.271	0.94
37_V	123_F	1.27	0.94
77_T	91_L	1.266	0.94
106_T	114_R	1.236	0.93
22_L	114_R	1.232	0.93
121_F	143_M	1.23	0.93
76_T	92_V	1.217	0.93
132_F	135_V	1.199	0.92
20_T	114_R	1.199	0.92
108_L	114_R	1.192	0.92
31_Y	74_T	1.191	0.92
138_E	142_N	1.188	0.91
79_N	101_G	1.187	0.91
133_G	150_R	1.168	0.90
60_M	81_L	1.163	0.90
41_P	50_S	1.151	0.90
32_Q	83_S	1.151	0.90
82_T	86_S	1.144	0.89
62_A	136_F	1.144	0.89
25_Y	156_S	1.143	0.89
78_R	90_N	1.134	0.89
63_A	77_T	1.131	0.88
33_L	95_P	1.12	0.88
99_L	143_M	1.117	0.88
50_S	64_V	1.117	0.88
18_S	118_H	1.1	0.87
18_S	115_I	1.078	0.85
31_Y	83_S	1.064	0.84
68_K	121_F	1.062	0.84
57_P	83_S	1.062	0.84
127_L	131_A	1.059	0.84
28_E	84_N	1.044	0.82
45_P	147_F	1.041	0.82
66_V	143_M	1.035	0.82
46_G	142_N	1.033	0.82
71_I	100_I	1.03	0.81
22_L	112_A	1.029	0.81
43_F	147_F	1.026	0.81
30_M	113_C	1.021	0.80
42_Q	150_R	1.006	0.79
19_R	46_G	1.004	0.79

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1t17A	1	0.9051	99.9	0.553	Contact Map	0.429
2d4rA	4	0.8987	99.9	0.607	Contact Map	0.694
3p9vA	2	0.9114	99.8	0.657	Contact Map	0.437
3qszA	2	0.9873	99.8	0.659	Contact Map	0.516
3tfzA	6	0.9367	99.7	0.675	Contact Map	0.664
3tl1A	2	0.9114	99.7	0.683	Contact Map	0.553
3tvqA	1	0.9114	99.7	0.687	Contact Map	0.622
4n0gC	2	0.9241	99.6	0.694	Contact Map	0.532
3ggnA	2	0.9177	99.6	0.695	Contact Map	0.619
2pcsA	1	0.9051	99.6	0.698	Contact Map	0.5

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0415 seconds.