OPENSEQ.org - SECG - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

SECG - Protein-export membrane protein SecG

UniProt:	P0AG99	Sequence MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12095
Length:	110 (110)
Sequences:	450
Seq/Len:	4.09

SECG
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
9_F	66_I	3.079	1.00
16_L	20_I	2.456	1.00
9_F	67_S	2.253	1.00
30_M	46_S	2.082	1.00
57_A	61_T	2.041	1.00
30_M	42_L	1.897	1.00
18_G	22_L	1.707	0.99
49_G	53_T	1.683	0.99
12_V	62_L	1.643	0.99
55_M	59_L	1.58	0.98
50_N	53_T	1.575	0.98
26_K	33_S	1.455	0.97
65_I	69_V	1.358	0.95
25_G	28_A	1.354	0.95
33_S	36_A	1.337	0.95
13_A	36_A	1.328	0.94
50_N	54_R	1.301	0.93
5_L	66_I	1.299	0.93
99_A	102_A	1.257	0.92
24_Q	33_S	1.245	0.91
54_R	57_A	1.243	0.91
3_E	6_L	1.239	0.91
5_L	9_F	1.237	0.91
24_Q	32_A	1.236	0.91
38_A	41_T	1.227	0.91
12_V	59_L	1.21	0.90
25_G	30_M	1.205	0.89
100_A	103_K	1.198	0.89
25_G	29_D	1.191	0.89
105_T	110_N	1.151	0.86
22_L	52_M	1.149	0.86
25_G	43_F	1.119	0.84
11_I	15_G	1.115	0.84
99_A	103_K	1.102	0.83
15_G	19_L	1.094	0.82
33_S	46_S	1.093	0.82
25_G	44_G	1.092	0.82
100_A	104_P	1.078	0.81
26_K	43_F	1.077	0.81
26_K	44_G	1.071	0.80
6_L	49_G	1.063	0.80
40_A	71_G	1.053	0.79
67_S	74_N	1.047	0.78
9_F	69_V	1.038	0.78
19_L	64_F	1.037	0.77
32_A	48_S	1.029	0.77
24_Q	29_D	1.025	0.76
9_F	71_G	1.02	0.76
95_Q	98_P	1.019	0.76
35_G	47_G	1.008	0.75
28_A	32_A	1.007	0.74
98_P	106_S	1.007	0.74
14_I	17_V	1.003	0.74
25_G	34_F	1.002	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3dl8E	2	0.9091	99.9	0.323	Contact Map	0.04
2akhX	2	0.7	99.9	0.337	Contact Map	0
3dinE	2	0.6909	99.9	0.359	Contact Map	0.141
3j45G	1	0.5909	99.8	0.42	Contact Map	0.141
3lb6C	1	0.3545	1.8	0.947	Contact Map
1fjkA	1	0.2	1.8	0.947	Contact Map	0.248
3wdoA	1	1	1.8	0.947	Contact Map	0.12
2yp6A	4	0.4636	1.7	0.948	Contact Map	0
2cfqA	1	0.8273	1.6	0.949	Contact Map	0.17
4lepA	2	0.9818	1.5	0.949	Contact Map	0.164

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0136 seconds.