OPENSEQ.org - SECB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

SECB - Protein-export protein SecB

UniProt:	P0AG86	Sequence MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10937
Length:	155 (147)
Sequences:	457
Seq/Len:	3.11

SECB
Paralog alert: 0.02 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
23_F	121_G	3.438	1.00
15_R	122_T	2.443	1.00
95_A	137_F	2.365	1.00
67_S	70_E	2.244	1.00
84_F	102_C	2.069	1.00
21_I	117_M	1.929	1.00
62_V	110_A	1.85	0.99
17_Y	81_G	1.837	0.99
63_T	75_L	1.786	0.99
110_A	130_P	1.761	0.99
9_M	88_G	1.722	0.99
25_A	28_A	1.558	0.97
82_G	106_L	1.548	0.97
109_Y	115_T	1.543	0.97
82_G	102_C	1.533	0.97
60_L	110_A	1.523	0.96
140_Y	143_Q	1.494	0.96
44_L	131_V	1.485	0.96
78_V	110_A	1.473	0.95
65_T	75_L	1.47	0.95
86_I	89_I	1.461	0.95
59_V	79_Q	1.433	0.94
50_Q	53_D	1.379	0.93
4_Q	7_T	1.362	0.92
11_F	105_I	1.353	0.92
67_S	72_T	1.342	0.91
100_A	134_D	1.317	0.90
73_A	100_A	1.317	0.90
86_I	94_M	1.309	0.90
137_F	141_L	1.3	0.90
40_V	66_A	1.298	0.90
115_T	127_N	1.297	0.90
51_L	83_I	1.293	0.89
16_I	80_Q	1.265	0.88
34_K	137_F	1.247	0.87
14_Q	85_S	1.238	0.86
13_I	105_I	1.236	0.86
89_I	145_A	1.227	0.86
19_K	27_N	1.193	0.83
27_N	73_A	1.19	0.83
13_I	123_F	1.188	0.83
59_V	81_G	1.179	0.83
48_S	96_H	1.158	0.81
32_F	136_L	1.143	0.80
66_A	101_Y	1.138	0.79
18_T	52_A	1.123	0.78
112_E	128_L	1.122	0.78
122_T	137_F	1.121	0.78
104_N	134_D	1.118	0.78
58_V	103_P	1.115	0.77
101_Y	134_D	1.108	0.77
15_R	109_Y	1.107	0.77
57_E	81_G	1.088	0.75
43_D	137_F	1.075	0.74
36_W	125_Q	1.075	0.74
20_D	24_E	1.075	0.74
62_V	78_V	1.068	0.73
15_R	80_Q	1.055	0.72
74_F	88_G	1.052	0.71
2_S	7_T	1.041	0.70
100_A	122_T	1.036	0.70
96_H	100_A	1.032	0.69
30_H	49_S	1.032	0.69
31_V	62_V	1.03	0.69
44_L	102_C	1.024	0.68
11_F	65_T	1.022	0.68
122_T	127_N	1.02	0.68
45_D	140_Y	1.019	0.68
15_R	132_N	1.006	0.66
26_P	29_P	1.005	0.66

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1qynA	4	0.9871	100	0.159	Contact Map	0.594
1fx3A	4	1	100	0.187	Contact Map	0.612
2y69K	2	0.2903	15.9	0.954	Contact Map	1
4jvwA	4	0.6323	5.4	0.963	Contact Map	0
2f9yB	1	0.6258	4.6	0.964	Contact Map	0
4bh6I	8	0.1548	2.5	0.969	Contact Map	0
1p16A	2	0.4387	2.3	0.969	Contact Map	0.034
3ip4B	1	0.9742	2.3	0.969	Contact Map	0.068
1q5lA	1	0.4323	2.1	0.97	Contact Map	0.312
2d6fC	2	0.9677	2.1	0.97	Contact Map	0.084

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.085 seconds.