OPENSEQ.org - PURE - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PURE - N5-carboxyaminoimidazole ribonucleotide mutase

UniProt:	P0AG18	Sequence MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGAA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10793
Length:	169 (159)
Sequences:	1618
Seq/Len:	10.18

PURE
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
11_A	54_F	2.98	1.00
101_V	105_Y	2.968	1.00
59_E	149_N	2.8	1.00
17_K	162_N	2.616	1.00
64_Q	140_H	2.492	1.00
13_V	80_I	2.492	1.00
12_I	27_A	2.405	1.00
119_L	132_L	2.36	1.00
112_R	127_A	2.344	1.00
33_L	134_A	2.331	1.00
135_Q	152_R	2.33	1.00
77_P	107_I	2.308	1.00
137_L	144_L	2.169	1.00
89_L	119_L	2.117	1.00
52_F	83_K	2.105	1.00
49_D	56_E	2.097	1.00
23_M	91_V	2.084	1.00
59_E	145_H	2.052	1.00
11_A	63_Y	2.041	1.00
153_K	157_D	2.03	1.00
31_E	37_H	2.006	1.00
53_S	57_S	1.915	1.00
40_E	50_K	1.903	1.00
89_L	136_I	1.883	1.00
9_R	64_Q	1.858	1.00
32_I	154_A	1.847	1.00
94_Q	97_A	1.793	1.00
57_S	60_E	1.754	1.00
35_V	134_A	1.735	1.00
146_Q	150_D	1.722	1.00
47_T	159_V	1.703	1.00
157_D	161_E	1.696	1.00
23_M	69_G	1.689	1.00
94_Q	99_S	1.676	1.00
59_E	85_L	1.656	1.00
38_H	61_N	1.651	1.00
150_D	154_A	1.642	1.00
40_E	163_P	1.639	1.00
104_L	108_V	1.628	1.00
138_A	144_L	1.627	1.00
134_A	144_L	1.621	1.00
24_Q	28_E	1.567	1.00
33_L	147_R	1.546	1.00
85_L	149_N	1.524	1.00
98_L	121_I	1.518	1.00
27_A	37_H	1.495	1.00
27_A	39_V	1.48	1.00
143_E	147_R	1.342	0.99
85_L	145_H	1.337	0.99
21_A	24_Q	1.332	0.99
50_K	160_L	1.319	0.99
89_L	117_G	1.311	0.99
120_A	125_G	1.309	0.99
95_S	99_S	1.305	0.99
42_V	51_L	1.294	0.99
38_H	63_Y	1.235	0.98
54_F	63_Y	1.235	0.98
85_L	148_L	1.232	0.98
51_L	80_I	1.204	0.98
94_Q	122_G	1.202	0.98
64_Q	139_T	1.189	0.98
29_I	130_A	1.181	0.98
25_F	28_E	1.179	0.98
153_K	156_T	1.174	0.98
151_W	155_Q	1.158	0.97
9_R	36_P	1.152	0.97
47_T	50_K	1.15	0.97
28_E	32_I	1.117	0.96
64_Q	141_D	1.103	0.96
51_L	55_A	1.102	0.96
157_D	160_L	1.101	0.96
49_D	83_K	1.087	0.96
56_E	83_K	1.077	0.95
104_L	121_I	1.072	0.95
154_A	158_E	1.068	0.95
55_A	66_I	1.063	0.95
29_I	32_I	1.05	0.94
38_H	54_F	1.047	0.94
144_L	147_R	1.027	0.94
131_L	134_A	1.017	0.93
25_F	127_A	1.01	0.93
34_N	147_R	1.006	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3kuuA	4	1	100	0.182	Contact Map	0.748
4ay3A	4	0.9822	100	0.186	Contact Map	0.833
3trhA	16	0.9941	100	0.187	Contact Map	0.819
3lp6A	4	0.9882	100	0.187	Contact Map	0.779
3oowA	8	0.9822	100	0.188	Contact Map	0.846
3orsA	8	0.9586	100	0.189	Contact Map	0.89
4grdA	4	0.9941	100	0.189	Contact Map	0.841
1u11A	2	0.9941	100	0.191	Contact Map	0.68
1o4vA	1	0.9882	100	0.208	Contact Map	0.719
3rg8A	8	0.929	100	0.226	Contact Map	0.669

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0468 seconds.