OPENSEQ.org - NUOJ - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

NUOJ - NADH-quinone oxidoreductase subunit J

UniProt:	P0AFE0	Sequence MEFAFYICGLIAILATLRVITHTNPVHALLYLIISLLAISGVFFSLGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAILSAIMLVVIVYAILGVNDQGIDGTPISAKAVGITLFGPYVLAVELASMLLLAGLVVAFHVGREERAGEVLSNRKDDSAKRKTEEHA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12090
Length:	184 (169)
Sequences:	1371
Seq/Len:	8.11

NUOJ
Paralog alert: 0.06 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
12_A	38_A	2.833	1.00
44_F	52_G	2.58	1.00
8_C	41_G	2.501	1.00
17_L	21_T	2.328	1.00
142_E	145_S	2.228	1.00
25_P	70_V	2.146	1.00
12_A	35_S	2.098	1.00
5_F	9_G	2.049	1.00
152_L	156_F	2.004	1.00
3_F	7_I	1.897	1.00
33_I	64_M	1.723	1.00
140_A	145_S	1.701	1.00
67_F	70_V	1.7	1.00
18_R	31_Y	1.681	1.00
128_A	131_I	1.563	1.00
43_F	55_E	1.548	1.00
18_R	21_T	1.545	1.00
22_H	31_Y	1.492	1.00
16_T	35_S	1.482	0.99
25_P	74_L	1.466	0.99
52_G	154_V	1.465	0.99
28_A	154_V	1.382	0.99
131_I	136_P	1.38	0.99
15_A	141_V	1.38	0.99
36_L	65_V	1.375	0.99
70_V	74_L	1.367	0.99
10_L	14_L	1.355	0.99
166_E	169_S	1.31	0.98
49_Y	125_S	1.305	0.98
6_Y	10_L	1.299	0.98
138_V	142_E	1.297	0.98
95_G	103_M	1.295	0.98
44_F	68_V	1.286	0.98
3_F	113_G	1.272	0.98
43_F	154_V	1.271	0.98
25_P	58_V	1.255	0.98
149_L	152_L	1.254	0.98
48_A	142_E	1.254	0.98
18_R	22_H	1.247	0.98
155_A	159_G	1.244	0.98
132_T	136_P	1.233	0.97
124_I	127_K	1.208	0.97
4_A	8_C	1.196	0.97
43_F	54_L	1.195	0.97
67_F	74_L	1.194	0.97
12_A	39_I	1.19	0.97
105_V	109_Y	1.178	0.96
49_Y	126_A	1.176	0.96
53_A	126_A	1.168	0.96
109_Y	117_Q	1.153	0.96
14_L	112_L	1.151	0.96
38_A	42_V	1.15	0.96
47_G	54_L	1.15	0.96
149_L	156_F	1.148	0.96
145_S	152_L	1.148	0.96
15_A	31_Y	1.145	0.96
10_L	56_I	1.145	0.96
33_I	62_A	1.141	0.95
19_V	27_H	1.139	0.95
62_A	134_F	1.121	0.95
65_V	70_V	1.109	0.94
50_F	69_F	1.108	0.94
30_L	34_I	1.108	0.94
66_L	72_M	1.108	0.94
125_S	156_F	1.106	0.94
5_F	11_I	1.091	0.94
36_L	62_A	1.087	0.94
61_G	66_L	1.074	0.93
51_A	129_V	1.072	0.93
104_L	147_L	1.062	0.93
27_H	31_Y	1.06	0.92
91_Q	95_G	1.058	0.92
57_I	63_I	1.037	0.91
60_A	160_R	1.035	0.91
43_F	73_M	1.028	0.91
25_P	76_L	1.028	0.91
43_F	48_A	1.027	0.91
58_V	64_M	1.025	0.91
15_A	18_R	1.013	0.90
86_Q	97_A	1.013	0.90
144_A	158_V	1.009	0.90
41_G	166_E	1.003	0.89
139_L	146_M	1.001	0.89
40_S	44_F	1.001	0.89

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3rkoJ	2	1	100	0.268	Contact Map	0.412
4he8J	2	0.9348	100	0.343	Contact Map	0.378
3l1lA	1	0.7772	11	0.949	Contact Map	0.074
3j01B	1	0.4076	8.7	0.951	Contact Map	0.07
4djkA	2	0.9022	8.1	0.952	Contact Map	0.124
2lp1A	1	0.4185	7.9	0.952	Contact Map	0.4
4i9wA	2	0.4022	6.5	0.954	Contact Map	0.474
2kluA	1	0.288	6.3	0.954	Contact Map	0.208
4dx5A	3	0.9022	6	0.954	Contact Map	0.328
3wdoA	1	0.9402	5.6	0.955	Contact Map	0.232

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0643 seconds.