OPENSEQ.org - BFD - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

BFD - Bacterioferritin-associated ferredoxin

UniProt:	P0AE56	Sequence MYVCLCNGISDKKIRQAVRQFSPHSFQQLKKFIPVGNQCGKCVRAAREVMEDELMQLPEFKESA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11181
Length:	64 (63)
Sequences:	268
Seq/Len:	4.25

BFD
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
29_L	50_M	2.645	1.00
2_Y	5_L	1.75	0.99
11_D	14_I	1.74	0.99
10_S	13_K	1.731	0.99
2_Y	8_G	1.719	0.99
1_M	4_C	1.692	0.99
36_G	43_V	1.613	0.99
23_P	29_L	1.46	0.97
59_E	62_E	1.404	0.96
29_L	35_V	1.402	0.96
18_V	44_R	1.399	0.96
38_Q	41_K	1.385	0.96
26_F	29_L	1.382	0.96
9_I	33_I	1.358	0.95
18_V	50_M	1.356	0.95
26_F	50_M	1.33	0.95
7_N	27_Q	1.308	0.94
18_V	54_L	1.282	0.93
58_P	61_K	1.279	0.93
30_K	41_K	1.269	0.93
17_A	20_Q	1.225	0.91
26_F	36_G	1.193	0.90
16_Q	45_A	1.186	0.89
14_I	36_G	1.175	0.89
17_A	22_S	1.174	0.88
14_I	46_A	1.15	0.87
43_V	47_R	1.122	0.85
28_Q	46_A	1.103	0.84
11_D	15_R	1.06	0.80
19_R	53_E	1.057	0.80
2_Y	10_S	1.042	0.79
46_A	49_V	1.022	0.77
10_S	33_I	1.011	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
4e6kG	3	0.9844	99.4	0.375	Contact Map	0.657
2hu9A	2	0.7812	98.6	0.55	Contact Map	0.457
2gagA	1	0.9844	98	0.619	Contact Map	0.524
1y56A	1	0.9688	96.8	0.692	Contact Map	0.507
2qcuA	2	0.9531	60.9	0.831	Contact Map	0.39
3da1A	1	1	59.8	0.832	Contact Map	0.352
1cttA	1	0.7969	8.7	0.891	Contact Map	0.139
3o2kA	1	0.8594	5.9	0.899	Contact Map	0.247
2rghA	1	1	5.8	0.9	Contact Map	0.506
3zyvA	4	0.9062	3.9	0.907	Contact Map	0.228

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.7546 seconds.