OPENSEQ.org - ZAPA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

ZAPA - Cell division protein ZapA

UniProt:	P0ADS2	Sequence MSAQPVDIQIFGRSLRVNCPPDQRDALNQAADDLNQRLQDLKERTRVTNTEQLVFIAALNISYELAQEKAKTRDYAASMEQRIRMLQQTIEQALLEQGRITEKTNQNFE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12878
Length:	109 (100)
Sequences:	264
Seq/Len:	2.64

ZAPA
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
33_D	61_I	2.052	1.00
49_N	56_I	2.044	1.00
38_L	54_V	2.026	1.00
38_L	52_Q	1.978	0.99
33_D	37_R	1.949	0.99
38_L	53_L	1.895	0.99
17_V	63_Y	1.701	0.98
13_R	49_N	1.668	0.97
31_A	86_L	1.593	0.96
45_T	53_L	1.593	0.96
15_L	55_F	1.542	0.95
34_L	40_D	1.542	0.95
34_L	62_S	1.53	0.95
87_Q	90_I	1.495	0.94
20_P	59_L	1.491	0.94
87_Q	91_E	1.47	0.94
41_L	53_L	1.424	0.92
9_Q	12_G	1.424	0.92
20_P	60_N	1.371	0.90
86_L	93_A	1.365	0.90
35_N	39_Q	1.32	0.88
32_D	35_N	1.307	0.87
5_P	64_E	1.307	0.87
10_I	55_F	1.274	0.85
12_G	83_I	1.214	0.81
24_R	50_T	1.198	0.80
51_E	96_E	1.187	0.79
10_I	44_R	1.164	0.77
35_N	54_V	1.133	0.75
35_N	52_Q	1.126	0.74
64_E	90_I	1.117	0.73
5_P	31_A	1.115	0.73
20_P	87_Q	1.11	0.72
24_R	39_Q	1.109	0.72
7_D	13_R	1.108	0.72
38_L	49_N	1.106	0.72
46_R	54_V	1.1	0.71
41_L	45_T	1.093	0.71
37_R	66_A	1.085	0.70
18_N	56_I	1.072	0.69
41_L	54_V	1.067	0.68
11_F	15_L	1.067	0.68
24_R	28_N	1.062	0.68
56_I	66_A	1.062	0.68
12_G	42_K	1.046	0.66
25_D	32_D	1.043	0.66
84_R	88_Q	1.042	0.65
26_A	34_L	1.041	0.65
29_Q	32_D	1.034	0.65
60_N	63_Y	1.03	0.64
15_L	54_V	1.027	0.64
19_C	64_E	1.014	0.62
49_N	52_Q	1.004	0.61
68_E	71_K	1.003	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1t3uA	4	0.945	99.9	0.37	Contact Map	0.396
3hnwA	2	0.9908	99.8	0.444	Contact Map	0.351
4ldrA	2	0.9358	11.9	0.926	Contact Map	0.146
4jkvA	2	0.7431	11.6	0.926	Contact Map	0.242
4jvyA	2	0.6697	7.6	0.932	Contact Map	0.074
3ppmA	2	0.3486	6.6	0.934	Contact Map	0.439
1tr2A	2	1	5.7	0.936	Contact Map	0.288
3h4pa	14	0.4312	5.4	0.936	Contact Map	0.079
4a0gA	4	0.4037	5	0.937	Contact Map	0.155
1s0aA	2	0.422	4.6	0.939	Contact Map	0.282

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.2439 seconds.