OPENSEQ.org - YQAA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YQAA - Inner membrane protein YqaA

UniProt:	P0ADR0	Sequence MSEALSLFSLFASSFLSATLLPGNSEVVLVAMLLSGISHPWVLVLTATMGNSLGGLTNVILGRFFPLRKTSRWQEKATGWLKRYGAVTLLLSWMPVVGDLLCLLAGWMRISWGPVIFFLCLGKALRYVAVAAATVQGMMWWH	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13529
Length:	142 (136)
Sequences:	492
Seq/Len:	3.62

YQAA
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
48_T	124_A	4.968	1.00
15_F	57_T	4.396	1.00
52_S	120_C	3.277	1.00
115_V	119_L	2.939	1.00
13_S	28_V	2.256	1.00
30_V	134_T	2.166	1.00
86_A	114_P	1.972	1.00
92_S	122_G	1.947	1.00
56_L	112_W	1.789	0.99
11_F	50_G	1.754	0.99
15_F	53_L	1.745	0.99
57_T	61_L	1.715	0.99
20_L	103_L	1.711	0.99
97_V	100_L	1.61	0.98
44_V	131_A	1.591	0.98
9_S	13_S	1.562	0.98
58_N	102_C	1.557	0.98
117_F	121_L	1.552	0.98
29_L	59_V	1.477	0.97
18_A	58_N	1.458	0.96
30_V	130_V	1.452	0.96
31_A	129_A	1.429	0.96
122_G	125_L	1.299	0.92
17_S	23_G	1.297	0.92
89_L	105_A	1.297	0.92
32_M	43_L	1.285	0.91
16_L	122_G	1.242	0.89
27_V	131_A	1.238	0.89
112_W	115_V	1.236	0.89
13_S	17_S	1.22	0.88
73_W	76_K	1.211	0.88
16_L	23_G	1.196	0.87
56_L	116_I	1.192	0.87
18_A	99_D	1.185	0.86
37_I	40_P	1.18	0.86
24_N	122_G	1.17	0.85
24_N	91_L	1.165	0.85
59_V	112_W	1.16	0.85
100_L	119_L	1.148	0.84
6_S	12_A	1.146	0.84
13_S	23_G	1.141	0.83
43_L	58_N	1.136	0.83
55_G	119_L	1.118	0.81
90_L	93_W	1.115	0.81
44_V	128_V	1.103	0.80
91_L	94_M	1.101	0.80
90_L	121_L	1.093	0.79
93_W	105_A	1.089	0.79
19_T	99_D	1.079	0.78
110_I	122_G	1.071	0.77
44_V	133_A	1.064	0.77
116_I	120_C	1.057	0.76
102_C	107_W	1.055	0.76
45_L	124_A	1.051	0.76
125_L	128_V	1.05	0.75
56_L	83_R	1.046	0.75
10_L	32_M	1.046	0.75
123_K	127_Y	1.044	0.75
81_L	88_T	1.043	0.75
128_V	132_A	1.037	0.74
92_S	101_L	1.027	0.73
20_L	114_P	1.019	0.72
10_L	29_L	1.019	0.72
20_L	100_L	1.007	0.71
29_L	33_L	1.007	0.71
16_L	28_V	1.006	0.71

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
3tdsE	5	0.5	15.9	0.943	Contact Map	0.236
3klyA	5	0.493	9.3	0.949	Contact Map	0.203
3kcuA	5	0.507	9.2	0.949	Contact Map	0.001
4fc4A	10	0.5211	6.6	0.952	Contact Map	0.24
3arcI	2	0.169	1.9	0.964	Contact Map	0.759
2jwaA	2	0.3099	1.5	0.965	Contact Map	0.296
2kluA	1	0.3944	1.2	0.967	Contact Map	0.162
2lbgA	1	0.1901	1.1	0.968	Contact Map	0.001
4hlsA	2	0.5493	1.1	0.968	Contact Map	0.078
1tpxA	1	0.4648	1.1	0.969	Contact Map	0.054

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0083 seconds.