OPENSEQ.org - YGAU - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YGAU - Uncharacterized protein YgaU

UniProt:	P0ADE6	Sequence MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYTVKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12675
Length:	149 (148)
Sequences:	180
Seq/Len:	1.22

YGAU
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
108_S	118_A	2.902	1.00
108_S	112_K	2.456	0.99
108_S	119_N	2.351	0.99
112_K	118_A	2.194	0.99
102_K	113_Q	2.116	0.98
63_S	66_A	2.065	0.98
100_T	143_V	2.01	0.97
106_T	109_A	1.995	0.97
111_S	118_A	1.808	0.94
106_T	121_Y	1.729	0.92
117_N	120_L	1.675	0.90
67_K	71_L	1.675	0.90
111_S	122_N	1.662	0.89
120_L	123_K	1.602	0.87
97_Q	113_Q	1.579	0.86
51_A	56_T	1.561	0.85
31_V	74_V	1.556	0.85
112_K	119_N	1.547	0.84
71_L	85_D	1.528	0.83
126_E	136_D	1.522	0.83
2_G	95_A	1.451	0.79
108_S	121_Y	1.446	0.78
111_S	135_P	1.446	0.78
108_S	117_N	1.438	0.78
97_Q	114_V	1.434	0.78
50_I	79_G	1.422	0.77
98_F	143_V	1.416	0.76
67_K	85_D	1.372	0.73
72_V	145_R	1.354	0.72
24_K	27_Q	1.354	0.72
32_Q	36_N	1.352	0.71
54_K	122_N	1.334	0.70
30_K	55_A	1.322	0.69
65_E	93_A	1.289	0.66
4_F	115_Y	1.266	0.64
87_V	99_Y	1.266	0.64
52_D	55_A	1.257	0.63
68_E	145_R	1.256	0.63
37_K	133_K	1.25	0.63
54_K	82_S	1.248	0.62
112_K	121_Y	1.236	0.61
126_E	129_K	1.213	0.59
57_V	70_I	1.21	0.59
89_T	95_A	1.193	0.57
42_D	70_I	1.18	0.56
54_K	84_D	1.152	0.53
39_G	70_I	1.144	0.53
111_S	117_N	1.143	0.52
64_Q	89_T	1.136	0.52
31_V	62_L	1.126	0.51
32_Q	47_N	1.125	0.51
33_E	58_T	1.115	0.50
119_N	122_N	1.115	0.50
21_Q	29_K	1.11	0.49
74_V	98_F	1.108	0.49
125_F	132_L	1.103	0.49
68_E	96_S	1.094	0.48
9_D	12_E	1.092	0.47
73_A	87_V	1.078	0.46
7_V	67_K	1.077	0.46
55_A	80_I	1.072	0.46
15_W	20_G	1.071	0.45
99_Y	106_T	1.066	0.45
126_E	134_S	1.06	0.44
16_D	20_G	1.056	0.44
51_A	54_K	1.049	0.43
133_K	137_K	1.036	0.42
44_D	48_I	1.035	0.42
40_I	61_G	1.035	0.42
53_G	100_T	1.026	0.41
121_Y	134_S	1.009	0.40
37_K	57_V	1.009	0.40
99_Y	114_V	1.005	0.39
72_V	82_S	1.001	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2ltfA	1	0.3557	99.5	0.76	Contact Map	0.355
2djpA	1	0.4228	99.1	0.803	Contact Map	0.352
1xovA	1	0.8456	99	0.808	Contact Map	0.023
1e0gA	1	0.3221	98.9	0.818	Contact Map	0.329
2l9yA	1	0.6913	98.8	0.823	Contact Map	0.365
4ebyA	1	0.4027	98.7	0.829	Contact Map	0.295
2gu1A	1	0.3826	98.7	0.829	Contact Map	0.265
4lzhA	1	0.4497	98.4	0.847	Contact Map	0.391
4b8vA	1	0.5302	98.4	0.848	Contact Map	0.334
3sluA	2	0.443	97.2	0.882	Contact Map	0.421

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.021 seconds.