OPENSEQ.org - YTFK - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YTFK - Uncharacterized protein YtfK

UniProt:	P0ADE2	Sequence MKIFQRYNPLQVAKYVKILFRGRLYIKDVGAFEFDKGKILIPKVKDKLHLSVMSEVNRQVMRLQTEMA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12511
Length:	68 (67)
Sequences:	69
Seq/Len:	1.03

YTFK
Paralog alert: 0.03 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
52_V	56_V	2.317	0.99
2_K	12_V	1.825	0.92
2_K	65_T	1.625	0.85
7_Y	55_E	1.547	0.80
11_Q	14_K	1.469	0.75
19_L	63_L	1.461	0.75
16_V	56_V	1.437	0.73
5_Q	14_K	1.334	0.65
12_V	67_M	1.277	0.60
24_L	51_S	1.276	0.60
15_Y	21_R	1.265	0.59
3_I	15_Y	1.262	0.59
12_V	40_L	1.253	0.58
1_M	8_N	1.223	0.55
41_I	48_L	1.219	0.55
6_R	19_L	1.218	0.55
29_V	50_L	1.214	0.54
15_Y	24_L	1.2	0.53
17_K	46_D	1.187	0.52
40_L	56_V	1.148	0.48
1_M	49_H	1.142	0.47
1_M	60_V	1.134	0.47
24_L	62_R	1.119	0.45
21_R	38_K	1.1	0.44
47_K	53_M	1.1	0.44
11_Q	50_L	1.093	0.43
14_K	50_L	1.088	0.42
1_M	14_K	1.075	0.41
23_R	49_H	1.074	0.41
29_V	33_E	1.074	0.41
28_D	36_K	1.074	0.41
5_Q	36_K	1.069	0.41
3_I	31_A	1.04	0.38
3_I	43_K	1.04	0.38
26_I	32_F	1.03	0.37
14_K	29_V	1.024	0.37
16_V	52_V	1.023	0.37
41_I	67_M	1.021	0.36
11_Q	32_F	1.012	0.36
14_K	58_R	1.01	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2jroA	1	1	100	0.026	Contact Map	0.056
1wzaA	1	0.9559	11.3	0.91	Contact Map	0.214
3k8kA	2	0.9412	10.8	0.911	Contact Map	0.079
1o7dA	1	0.8824	10.3	0.912	Contact Map	0.13
4h54A	2	0.9559	7.5	0.917	Contact Map	0.12
4bjuA	2	0.9853	7.2	0.918	Contact Map	0.11
3uw2A	1	0.9853	7.2	0.918	Contact Map	0.056
3bvxA	1	0.8824	7.1	0.918	Contact Map	0.036
2jwyA	1	0.4265	6.7	0.919	Contact Map	0
2ig8A	3	1	6.5	0.919	Contact Map	0.072

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0144 seconds.