OPENSEQ.org - YEJL - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YEJL - UPF0352 protein YejL

UniProt:	P0AD24	Sequence MPQISRYSDEQVEQLLAELLNVLEKHKAPTDLSLMVLGNMVTNLINTSIAPAQRQAIANSFARALQSSINEDKAH	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12043
Length:	75 (75)
Sequences:	101
Seq/Len:	1.35

YEJL
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
43_N	53_Q	1.727	0.93
42_T	68_S	1.636	0.90
3_Q	6_R	1.57	0.87
15_L	51_P	1.52	0.85
44_L	47_T	1.512	0.85
9_D	53_Q	1.464	0.82
57_I	67_S	1.427	0.80
30_T	47_T	1.414	0.79
50_A	66_Q	1.355	0.75
14_Q	26_H	1.35	0.74
57_I	63_R	1.301	0.70
8_S	13_E	1.295	0.70
20_L	30_T	1.295	0.70
16_L	22_V	1.286	0.69
11_Q	27_K	1.256	0.66
10_E	62_A	1.244	0.65
11_Q	26_H	1.214	0.62
12_V	18_E	1.191	0.60
14_Q	17_A	1.188	0.60
8_S	69_I	1.181	0.59
2_P	45_I	1.178	0.59
25_K	59_N	1.163	0.57
27_K	52_A	1.162	0.57
40_M	57_I	1.123	0.54
12_V	22_V	1.107	0.52
19_L	35_M	1.102	0.51
16_L	40_M	1.094	0.51
12_V	64_A	1.093	0.51
11_Q	70_N	1.09	0.50
3_Q	8_S	1.085	0.50
8_S	49_I	1.081	0.49
59_N	63_R	1.076	0.49
29_P	69_I	1.065	0.48
31_D	37_L	1.062	0.47
40_M	48_S	1.05	0.46
26_H	69_I	1.049	0.46
13_E	64_A	1.047	0.46
30_T	64_A	1.039	0.45
11_Q	74_A	1.036	0.45
33_S	72_D	1.034	0.45
48_S	53_Q	1.022	0.43
19_L	71_E	1.009	0.42
33_S	66_Q	1.007	0.42
29_P	37_L	1	0.41

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2jrxA	2	1	100	-0.004	Contact Map	0.185
2jpqA	2	1	100	0	Contact Map	0.103
2juzA	2	1	100	0.017	Contact Map	0.184
2juwA	2	1	100	0.018	Contact Map	0.15
2jr2A	2	0.9867	100	0.039	Contact Map	0.141
3t5sA	1	0.9867	39.6	0.898	Contact Map	0.02
3c6vA	3	1	29.8	0.904	Contact Map	0.079
3fwtA	1	0.9867	28	0.905	Contact Map	0.038
3fwuA	1	0.9867	23.2	0.909	Contact Map	0.049
3uwcA	1	0.3867	21.6	0.91	Contact Map	0.11

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.