OPENSEQ.org - YDCH - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YDCH - Uncharacterized protein YdcH

UniProt:	P0ACW6	Sequence MFPEYRDLISRLKNENPRFMSLFDKHNKLDHEIARKEGSDGRGYNAEVVRMKKQKLQLKDEMLKILQQESVKEV	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12865
Length:	74 (71)
Sequences:	323
Seq/Len:	4.55

YDCH
Paralog alert: 0.05 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
25_K	54_Q	3.136	1.00
11_R	15_E	2.496	1.00
1_M	55_K	1.924	1.00
18_R	21_S	1.741	1.00
45_N	48_V	1.714	0.99
26_H	55_K	1.709	0.99
34_A	38_G	1.654	0.99
1_M	26_H	1.534	0.98
30_D	34_A	1.522	0.98
49_V	53_K	1.459	0.98
50_R	54_Q	1.356	0.96
36_K	48_V	1.334	0.95
16_N	68_Q	1.319	0.95
23_F	27_N	1.29	0.94
49_V	56_L	1.261	0.93
9_I	63_L	1.238	0.93
10_S	13_K	1.228	0.92
6_R	27_N	1.227	0.92
3_P	66_L	1.206	0.91
36_K	43_G	1.203	0.91
36_K	52_K	1.202	0.91
33_I	43_G	1.184	0.90
16_N	65_I	1.182	0.90
54_Q	57_Q	1.18	0.90
57_Q	61_E	1.169	0.89
43_G	47_E	1.159	0.89
31_H	35_R	1.13	0.87
35_R	40_D	1.106	0.86
26_H	48_V	1.103	0.85
29_L	44_Y	1.087	0.84
21_S	25_K	1.066	0.83
28_K	32_E	1.064	0.82
6_R	23_F	1.061	0.82
27_N	31_H	1.059	0.82
9_I	62_M	1.054	0.82
35_R	41_G	1.051	0.81
29_L	52_K	1.038	0.80
30_D	36_K	1.027	0.79
32_E	41_G	1.014	0.78

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1zhcA	1	0.973	99.8	0.213	Contact Map	0.396
4g63A	1	1	20.4	0.883	Contact Map	0.31
2a3dA	1	0.8243	15	0.89	Contact Map	0.112
1deqA	4	0.9459	11.7	0.895	Contact Map	0.063
3ojaB	1	0.9865	10.1	0.898	Contact Map	0.208
2x6uA	1	0.5	9.9	0.898	Contact Map	0.987
3ra3B	2	0.3784	8.9	0.9	Contact Map	0.599
3ghgA	4	1	8.8	0.9	Contact Map	0.18
2oeqA	4	0.9865	7.2	0.905	Contact Map	0.478
4a04A	2	0.3378	7	0.905	Contact Map	0.281

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0488 seconds.