OPENSEQ.org - WCAB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

WCAB - Putative colanic acid biosynthesis acetyltransferase WcaB

UniProt:	P0ACC9	Sequence MLEDLRANSWSLRPCCMVLAYRVAHFCSVWRKKNVLNNLWAAPLLVLYRIITECFFGYEIQAAATIGRRFTIHHGYAVVINKNVVAGDDFTIRHGVTIGNRGADNMACPHIGNGVELGANVIILGDITLGNNVTVGAGSVVLDSVPDNALVVGEKARVKVIK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13570
Length:	162 (152)
Sequences:	1752
Seq/Len:	11.53

WCAB
Paralog alert: 0.33 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
112_G	131_N	4.747	1.00
111_I	117_L	4.116	1.00
68_R	88_D	3.555	1.00
114_G	132_N	3.468	1.00
69_R	89_D	3.033	1.00
132_N	148_N	2.954	1.00
113_N	131_N	2.755	1.00
89_D	114_G	2.676	1.00
87_G	113_N	2.62	1.00
127_I	144_S	2.611	1.00
151_V	156_A	2.528	1.00
112_G	128_T	2.472	1.00
58_Y	75_G	2.449	1.00
65_T	85_V	2.443	1.00
131_N	147_D	2.296	1.00
87_G	112_G	2.294	1.00
133_V	149_A	2.157	1.00
67_G	88_D	2.061	1.00
128_T	144_S	1.927	1.00
90_F	111_I	1.848	1.00
106_M	110_H	1.828	1.00
88_D	113_N	1.815	1.00
146_P	158_V	1.752	1.00
70_F	113_N	1.706	1.00
136_G	152_V	1.705	1.00
122_I	138_G	1.573	1.00
63_A	82_K	1.557	1.00
120_N	138_G	1.554	1.00
34_N	37_N	1.528	1.00
111_I	129_L	1.527	1.00
149_A	158_V	1.429	1.00
145_V	151_V	1.418	1.00
59_E	76_Y	1.398	0.99
133_V	145_V	1.393	0.99
72_I	78_V	1.387	0.99
25_H	65_T	1.369	0.99
133_V	147_D	1.343	0.99
11_S	16_C	1.342	0.99
12_L	16_C	1.323	0.99
89_D	113_N	1.301	0.99
134_T	150_L	1.294	0.99
94_H	97_T	1.28	0.99
57_G	76_Y	1.276	0.99
92_I	117_L	1.259	0.99
85_V	126_D	1.212	0.98
85_V	110_H	1.196	0.98
129_L	135_V	1.178	0.98
153_G	156_A	1.172	0.98
18_V	70_F	1.171	0.98
112_G	133_V	1.162	0.97
26_F	30_W	1.155	0.97
68_R	89_D	1.153	0.97
131_N	148_N	1.137	0.97
114_G	131_N	1.135	0.97
21_Y	52_T	1.101	0.96
20_A	52_T	1.095	0.96
11_S	15_C	1.083	0.96
123_I	127_I	1.082	0.96
90_F	113_N	1.07	0.95
69_R	88_D	1.069	0.95
10_W	14_P	1.067	0.95
14_P	46_V	1.066	0.95
117_L	135_V	1.064	0.95
112_G	147_D	1.06	0.95
94_H	126_D	1.046	0.94
61_Q	81_N	1.042	0.94
130_G	147_D	1.034	0.94
70_F	92_I	1.023	0.93
44_L	48_Y	1.023	0.93
81_N	108_C	1.021	0.93
73_H	107_A	1.016	0.93
151_V	158_V	1.01	0.93
13_R	16_C	1.007	0.93
66_I	70_F	1.006	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
4n6aA	2	0.9444	100	0.39	Contact Map	0.767
3q1xA	1	0.9444	100	0.408	Contact Map	0.768
4h7oA	3	0.9444	100	0.415	Contact Map	0.856
1ssqA	2	0.9444	100	0.421	Contact Map	0.836
3f1xA	1	0.9444	100	0.431	Contact Map	0.779
3mc4A	2	0.9444	100	0.436	Contact Map	0.836
1t3dA	3	0.9444	100	0.438	Contact Map	0.858
3srtA	2	0.9877	99.9	0.604	Contact Map	0.784
1krrA	3	0.9877	99.9	0.607	Contact Map	0.788
2p2oA	6	0.9877	99.9	0.607	Contact Map	0.787

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0142 seconds.