OPENSEQ.org - DHSD - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

DHSD - Succinate dehydrogenase hydrophobic membrane anchor subunit

UniProt:	P0AC44	Sequence MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10934
Length:	115 (115)
Sequences:	260
Seq/Len:	2.26

DHSD
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
26_L	64_A	2.204	1.00
80_L	93_L	2.062	0.99
77_W	81_T	2.019	0.99
65_L	69_L	1.701	0.97
100_A	104_Y	1.679	0.97
32_Y	51_F	1.58	0.95
6_S	11_N	1.559	0.94
44_T	74_I	1.502	0.93
32_Y	60_F	1.482	0.92
65_L	108_G	1.459	0.91
50_G	96_V	1.457	0.91
6_S	10_R	1.44	0.91
13_V	16_F	1.415	0.90
51_F	57_T	1.391	0.89
106_I	114_G	1.386	0.88
80_L	97_I	1.376	0.88
37_F	49_I	1.363	0.87
29_Y	60_F	1.355	0.87
97_I	101_L	1.347	0.86
22_T	70_I	1.331	0.85
78_Q	81_T	1.315	0.84
25_V	64_A	1.314	0.84
5_A	11_N	1.306	0.84
34_V	38_A	1.278	0.82
15_D	113_W	1.26	0.81
58_K	115_V	1.245	0.80
25_V	58_K	1.235	0.79
89_L	92_M	1.231	0.79
3_S	6_S	1.23	0.79
76_M	97_I	1.213	0.77
26_L	35_G	1.201	0.76
37_F	109_F	1.192	0.76
7_A	11_N	1.186	0.75
60_F	65_L	1.182	0.75
36_F	51_F	1.168	0.73
37_F	43_L	1.166	0.73
59_V	79_V	1.159	0.73
94_Q	98_V	1.148	0.72
3_S	7_A	1.141	0.71
8_L	11_N	1.136	0.70
27_T	34_V	1.117	0.69
72_A	111_V	1.115	0.68
11_N	77_W	1.112	0.68
33_M	45_Y	1.095	0.66
74_I	95_L	1.092	0.66
49_I	53_A	1.087	0.66
53_A	89_L	1.086	0.65
62_L	114_G	1.082	0.65
53_A	85_K	1.07	0.64
25_V	35_G	1.067	0.63
63_L	67_S	1.064	0.63
16_F	64_A	1.051	0.62
52_F	61_T	1.047	0.61
29_Y	65_L	1.043	0.61
47_V	63_L	1.041	0.61
35_G	44_T	1.041	0.61
33_M	42_E	1.041	0.61
91_L	97_I	1.039	0.60
40_S	47_V	1.026	0.59
68_I	76_M	1.019	0.58
93_L	103_V	1.017	0.58
17_I	98_V	1.016	0.58
1_M	10_R	1.012	0.57
16_F	91_L	1.003	0.56
13_V	19_V	1.002	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2wdqD	3	1	99.9	0.428	Contact Map	0.426
2h88D	2	0.7739	99.6	0.605	Contact Map	0.386
2wdqC	3	0.9739	99.4	0.648	Contact Map	0.184
1zoyC	1	0.9478	99.1	0.683	Contact Map	0.211
2h88C	2	0.9478	99.1	0.684	Contact Map	0.219
3vr8C	2	0.9913	98.9	0.712	Contact Map	0.192
3vr8D	2	0.8348	98.8	0.725	Contact Map	0.332
2bs2C	2	0.9652	97.2	0.813	Contact Map	0.416
1kf6C	2	0.9478	84.6	0.883	Contact Map	0.287
3dinE	2	0.3565	6.3	0.941	Contact Map	0.091

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0308 seconds.