OPENSEQ.org - FLIT - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

FLIT - Flagellar protein FliT

UniProt:	P0ABY2	Sequence MNHAPHLYFAWQQLVEKSQLMLRLATEEQWDELIASEMAYVNAVQEIAHLTEEVDPSTTMQEQLRPMLRLILDNESKVKQLLQIRMDELAKLVGQSSVQKSVLSAYGDQGGFVLAPQDNLF	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11389
Length:	121 (118)
Sequences:	133
Seq/Len:	1.13

FLIT
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
77_K	80_Q	2.102	0.98
86_M	107_G	2.033	0.97
86_M	104_S	1.954	0.96
12_Q	63_Q	1.643	0.87
112_F	116_P	1.639	0.87
111_G	116_P	1.63	0.87
1_M	92_L	1.591	0.85
11_W	47_I	1.589	0.85
11_W	71_I	1.56	0.83
115_A	118_D	1.528	0.82
111_G	114_L	1.49	0.79
22_L	81_L	1.475	0.78
44_V	110_G	1.449	0.77
26_T	77_K	1.402	0.73
112_F	115_A	1.391	0.72
56_P	64_L	1.352	0.69
17_K	86_M	1.325	0.67
98_V	105_A	1.311	0.66
37_E	93_V	1.271	0.62
33_L	82_L	1.264	0.62
56_P	79_K	1.253	0.61
11_W	15_V	1.235	0.59
12_Q	79_K	1.229	0.58
94_G	98_V	1.227	0.58
13_Q	43_A	1.222	0.58
47_I	115_A	1.212	0.57
42_N	60_M	1.207	0.56
113_V	116_P	1.206	0.56
16_E	43_A	1.197	0.55
60_M	97_S	1.17	0.53
10_A	17_K	1.16	0.52
37_E	40_Y	1.159	0.52
40_Y	44_V	1.13	0.49
85_R	88_E	1.128	0.49
75_E	79_K	1.111	0.47
48_A	75_E	1.111	0.47
9_F	39_A	1.105	0.47
71_I	105_A	1.102	0.46
40_Y	74_N	1.099	0.46
7_L	11_W	1.099	0.46
18_S	22_L	1.092	0.45
54_V	105_A	1.081	0.44
13_Q	87_D	1.079	0.44
68_L	83_Q	1.075	0.44
61_Q	95_Q	1.072	0.43
11_W	89_L	1.07	0.43
15_V	71_I	1.068	0.43
44_V	68_L	1.065	0.43
35_A	52_E	1.061	0.42
24_L	75_E	1.056	0.42
3_H	118_D	1.052	0.42
29_Q	32_E	1.052	0.42
18_S	37_E	1.051	0.41
40_Y	85_R	1.048	0.41
82_L	99_Q	1.043	0.41
1_M	22_L	1.037	0.40
37_E	65_R	1.032	0.40
24_L	84_I	1.023	0.39
65_R	82_L	1.02	0.39
37_E	83_Q	1.012	0.38
8_Y	52_E	1.01	0.38
15_V	19_Q	1.009	0.38
20_L	28_E	1	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3a7mA	2	1	100	0.081	Contact Map	0.221
3nkzA	4	0.9835	100	0.097	Contact Map	0.354
3h3mA	2	0.9339	100	0.136	Contact Map	0.313
2fupA	1	0.9917	30.8	0.91	Contact Map	0.233
1f6kA	2	0.6033	18.1	0.919	Contact Map	0.355
2wkjA	4	0.6198	14.8	0.923	Contact Map	0.39
2nuwA	2	0.6612	14.2	0.923	Contact Map	0.314
1xkyA	4	0.7438	13.9	0.924	Contact Map	0.284
3opcA	2	0.9835	13.3	0.924	Contact Map	0.326
3na8A	4	0.7438	12.6	0.925	Contact Map	0.314

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.1622 seconds.