OPENSEQ.org - FLGB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

FLGB - Flagellar basal body rod protein FlgB

UniProt:	P0ABW9	Sequence MLDKLDAALRFQQEALNLRAQRQEVLAANIANADTPGYQARDIDFASELKKVMQRGRDATSVVALTMTSTQHIPAQALTPPTAELQYRIPDQPSLDGNTVDMDRERTQFADNSLQYQMSLSALSGQIKGMMNVLQSGN	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14266
Length:	138 (137)
Sequences:	867
Seq/Len:	6.33

FLGB
Paralog alert: 0.12 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
68_T	72_H	3.85	1.00
40_A	99_T	2.617	1.00
44_D	47_S	2.426	1.00
48_E	51_K	2.28	1.00
30_I	102_M	2.271	1.00
38_Y	41_R	2.137	1.00
22_R	42_D	2.077	1.00
108_Q	111_D	2.061	1.00
111_D	115_Q	1.999	1.00
9_L	127_I	1.89	1.00
19_R	112_N	1.846	1.00
28_A	38_Y	1.816	1.00
125_G	129_G	1.8	1.00
25_V	43_I	1.797	1.00
18_L	43_I	1.776	1.00
69_S	72_H	1.775	1.00
26_L	112_N	1.76	1.00
26_L	109_F	1.707	1.00
21_Q	24_E	1.702	1.00
67_M	74_P	1.535	0.99
25_V	38_Y	1.517	0.99
26_L	42_D	1.48	0.99
130_M	134_L	1.456	0.99
41_R	85_L	1.428	0.99
65_L	75_A	1.397	0.98
12_Q	119_S	1.391	0.98
48_E	52_V	1.388	0.98
19_R	28_A	1.339	0.98
65_L	68_T	1.338	0.98
117_Q	120_L	1.332	0.98
116_Y	120_L	1.319	0.97
120_L	124_S	1.312	0.97
34_D	92_Q	1.308	0.97
21_Q	43_I	1.276	0.97
14_E	17_N	1.247	0.96
126_Q	129_G	1.24	0.96
121_S	124_S	1.234	0.96
16_L	120_L	1.218	0.95
102_M	106_R	1.215	0.95
34_D	126_Q	1.213	0.95
121_S	127_I	1.189	0.95
103_D	106_R	1.179	0.94
121_S	125_G	1.167	0.94
9_L	38_Y	1.157	0.93
18_L	99_T	1.157	0.93
123_L	126_Q	1.137	0.93
5_L	127_I	1.109	0.91
68_T	73_I	1.1	0.91
39_Q	99_T	1.099	0.91
61_S	80_P	1.087	0.90
117_Q	124_S	1.086	0.90
23_Q	103_D	1.083	0.90
134_L	137_G	1.075	0.90
14_E	132_N	1.071	0.89
119_S	123_L	1.066	0.89
28_A	120_L	1.044	0.88
94_S	130_M	1.034	0.87
125_G	128_K	1.034	0.87
40_A	125_G	1.031	0.87
65_L	73_I	1.026	0.87
131_M	135_Q	1.024	0.86
65_L	72_H	1.023	0.86
11_F	102_M	1.017	0.86
9_L	75_A	1.008	0.85
104_R	108_Q	1.006	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
3a69A	1	0.7899	98.5	0.74	Contact Map	0.299
4ea3A	2	0.3551	11.5	0.932	Contact Map	0.459
2d4yA	2	0.6812	3.6	0.946	Contact Map	0.544
2jrxA	2	0.4855	3.2	0.948	Contact Map	0.199
2y5sA	2	0.7971	3	0.949	Contact Map	0.2
2jpqA	2	0.4855	2.8	0.949	Contact Map	0.267
1oryB	1	0.3986	2.2	0.952	Contact Map	0.57
2juzA	2	0.4638	2.2	0.952	Contact Map	0.251
2juwA	2	0.4638	2.1	0.953	Contact Map	0.383
3tr9A	4	0.7971	1.7	0.955	Contact Map	0.225

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0175 seconds.