OPENSEQ.org - DINI - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

DINI - DNA-damage-inducible protein I

UniProt:	P0ABR1	Sequence MRIEVTIAKTSPLPAGAIDALAGELSRRIQYAFPDNEGHVSVRYAAANNLSVIGATKEDKQRISEILQETWESADDWFVSE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12670
Length:	81 (80)
Sequences:	125
Seq/Len:	1.56

DINI
Paralog alert: 0.68 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
68_Q	72_E	2.047	0.98
8_A	11_S	1.851	0.97
33_F	42_V	1.85	0.97
27_R	62_R	1.613	0.91
35_D	42_V	1.596	0.91
59_D	62_R	1.499	0.87
23_G	37_E	1.449	0.84
7_I	59_D	1.403	0.82
58_E	62_R	1.363	0.79
3_I	11_S	1.343	0.78
45_A	78_F	1.328	0.76
31_Y	37_E	1.318	0.76
22_A	42_V	1.313	0.75
67_L	76_D	1.304	0.75
55_A	76_D	1.302	0.74
70_T	73_S	1.293	0.74
13_L	17_A	1.268	0.72
3_I	41_S	1.268	0.72
4_E	9_K	1.261	0.71
21_L	71_W	1.245	0.70
54_G	60_K	1.239	0.69
45_A	76_D	1.209	0.66
3_I	27_R	1.203	0.66
18_I	32_A	1.202	0.66
45_A	55_A	1.181	0.64
2_R	9_K	1.17	0.63
23_G	26_S	1.16	0.62
23_G	38_G	1.142	0.60
38_G	53_I	1.129	0.59
22_A	36_N	1.114	0.57
31_Y	38_G	1.108	0.56
22_A	38_G	1.101	0.56
43_R	48_N	1.099	0.55
29_I	80_S	1.082	0.54
50_L	74_A	1.054	0.51
6_T	70_T	1.054	0.51
11_S	37_E	1.042	0.50
1_M	13_L	1.04	0.49
27_R	53_I	1.038	0.49
34_P	48_N	1.035	0.49
20_A	71_W	1.035	0.49
14_P	17_A	1.017	0.47
27_R	61_Q	1.01	0.46

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1ghhA	1	1	100	0.075	Contact Map	0.172
1useA	1	0.3827	31.4	0.899	Contact Map	0.581
2olsA	1	0.9136	25.6	0.903	Contact Map	0.182
1eyhA	1	0.5432	20.3	0.908	Contact Map	0.068
4hn3A	4	0.7778	18.4	0.91	Contact Map	0.094
1ip9A	1	0.8025	15.5	0.912	Contact Map	0.166
3n2qA	1	0.7654	15.1	0.913	Contact Map	0.1
1yxbA	8	0.7407	14.3	0.914	Contact Map	0.31
2qx2A	1	0.8025	13.7	0.915	Contact Map	0.171
2z15A	4	0.9506	13.3	0.915	Contact Map	0.215

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.