OPENSEQ.org - YCBK - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YCBK - Uncharacterized protein YcbK

UniProt:	P0AB06	Sequence MDKFDANRRKLLALGGVALGAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPGLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKKSYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13703
Length:	182 (182)
Sequences:	330
Seq/Len:	1.81

YCBK
Paralog alert: 0.03 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
69_L	89_F	3.412	1.00
101_T	145_G	2.248	1.00
105_V	143_I	2.125	0.99
61_Y	90_D	2.074	0.99
80_K	115_D	2.015	0.99
132_Y	178_P	1.934	0.98
75_D	116_T	1.841	0.97
114_I	134_T	1.831	0.97
124_S	127_V	1.787	0.97
31_T	35_P	1.714	0.96
77_R	169_S	1.653	0.94
152_R	165_Y	1.564	0.92
142_H	170_N	1.55	0.91
155_A	174_I	1.54	0.91
132_Y	137_Q	1.534	0.91
95_L	174_I	1.524	0.90
132_Y	135_K	1.517	0.90
43_N	106_Q	1.501	0.90
51_I	65_E	1.471	0.88
16_G	33_S	1.47	0.88
156_L	181_H	1.46	0.88
73_F	107_L	1.456	0.88
148_L	167_P	1.447	0.87
81_I	84_I	1.447	0.87
126_G	169_S	1.434	0.87
151_I	174_I	1.392	0.84
77_R	116_T	1.392	0.84
78_A	115_D	1.384	0.84
84_I	114_I	1.358	0.82
46_H	76_Y	1.348	0.82
47_T	171_F	1.346	0.81
63_Q	86_P	1.33	0.80
94_R	160_A	1.324	0.80
84_I	89_F	1.31	0.79
44_N	53_A	1.309	0.79
46_H	152_R	1.305	0.79
121_R	129_K	1.286	0.77
29_F	33_S	1.282	0.77
99_L	157_S	1.279	0.77
72_F	110_G	1.264	0.75
49_E	74_R	1.26	0.75
57_D	62_I	1.249	0.74
55_F	110_G	1.245	0.74
107_L	139_M	1.231	0.73
56_F	59_R	1.23	0.73
79_N	125_R	1.203	0.70
39_I	54_E	1.197	0.70
51_I	151_I	1.193	0.69
163_V	171_F	1.192	0.69
73_F	95_L	1.189	0.69
25_P	30_A	1.175	0.68
84_I	134_T	1.155	0.66
127_V	169_S	1.155	0.66
113_S	170_N	1.15	0.65
61_Y	66_L	1.135	0.64
146_I	149_S	1.132	0.63
141_F	174_I	1.127	0.63
13_A	20_G	1.11	0.61
4_F	11_L	1.095	0.60
77_R	113_S	1.092	0.59
42_L	73_F	1.091	0.59
84_I	136_G	1.09	0.59
53_A	65_E	1.09	0.59
41_T	50_S	1.086	0.59
55_F	139_M	1.082	0.58
88_L	176_T	1.079	0.58
70_N	83_S	1.078	0.58
20_G	23_I	1.078	0.58
121_R	124_S	1.077	0.58
149_S	153_K	1.07	0.57
91_Q	176_T	1.063	0.56
45_L	108_I	1.061	0.56
95_L	154_A	1.06	0.56
72_F	181_H	1.053	0.55
72_F	107_L	1.05	0.55
148_L	165_Y	1.027	0.52
52_K	80_K	1.026	0.52
154_A	158_M	1.024	0.52
15_G	20_G	1.022	0.52
14_L	33_S	1.017	0.51
50_S	104_P	1.014	0.51
78_A	92_L	1.009	0.50
46_H	120_L	1.007	0.50
72_F	100_G	1.005	0.50
130_K	134_T	1	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3n1gB	2	0.8352	100	0.564	Contact Map	0.227
2ibgE	4	0.7582	100	0.617	Contact Map	0.301
3k7iB	1	0.8736	100	0.619	Contact Map	0.227
1lbuA	1	0.9121	99.8	0.704	Contact Map	0.247
1xp2A	3	0.6758	97.8	0.881	Contact Map	0.452
4mphA	2	0.7692	97.2	0.893	Contact Map	0.292
4murA	2	0.7747	95.6	0.91	Contact Map	0.44
4f78A	1	0.7747	94.7	0.915	Contact Map	0.375
4muqA	1	0.7747	94.7	0.915	Contact Map	0.341
4jidA	2	0.8846	92	0.924	Contact Map	0.347

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0616 seconds.