OPENSEQ.org - XGPT - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

XGPT - Xanthine phosphoribosyltransferase

UniProt:	P0A9M5	Sequence MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10414
Length:	152 (146)
Sequences:	709
Seq/Len:	4.86

XGPT
Paralog alert: 0.04 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
113_F	137_Q	2.403	1.00
98_V	102_E	2.391	1.00
36_S	40_L	2.071	1.00
41_V	45_L	1.977	1.00
35_V	100_I	1.809	1.00
30_K	83_G	1.777	1.00
27_E	124_D	1.636	0.99
30_K	82_E	1.595	0.99
91_V	97_A	1.569	0.99
20_A	46_L	1.558	0.99
90_L	115_K	1.546	0.99
101_R	105_P	1.541	0.99
7_V	11_M	1.513	0.99
91_V	118_G	1.458	0.98
34_A	43_G	1.443	0.98
35_V	55_V	1.415	0.97
71_L	74_L	1.383	0.97
58_V	100_I	1.355	0.96
13_Q	45_L	1.338	0.96
108_H	124_D	1.329	0.96
21_S	25_P	1.295	0.95
15_H	127_V	1.293	0.95
92_D	115_K	1.28	0.95
31_G	84_F	1.274	0.94
115_K	140_D	1.258	0.94
121_L	125_Y	1.258	0.94
5_Y	11_M	1.257	0.94
91_V	114_A	1.254	0.94
114_A	125_Y	1.252	0.94
32_I	46_L	1.24	0.93
46_L	87_I	1.233	0.93
44_A	48_R	1.229	0.93
8_T	11_M	1.221	0.93
18_K	21_S	1.217	0.93
30_K	84_F	1.215	0.92
98_V	119_R	1.207	0.92
9_W	138_P	1.198	0.92
11_M	15_H	1.197	0.92
26_S	144_V	1.189	0.91
26_S	147_P	1.189	0.91
144_V	147_P	1.187	0.91
8_T	45_L	1.185	0.91
30_K	50_L	1.175	0.91
89_D	94_G	1.174	0.91
143_V	147_P	1.158	0.90
44_A	59_C	1.149	0.89
22_R	25_P	1.142	0.89
99_A	102_E	1.142	0.89
142_G	146_V	1.139	0.89
47_A	57_T	1.137	0.89
67_N	86_V	1.137	0.89
23_L	42_P	1.123	0.88
11_M	14_I	1.123	0.88
16_A	45_L	1.119	0.88
32_I	41_V	1.096	0.86
93_T	128_D	1.09	0.86
23_L	28_Q	1.067	0.84
62_S	68_Q	1.066	0.84
37_R	47_A	1.066	0.84
36_S	55_V	1.06	0.84
18_K	127_V	1.055	0.83
16_A	46_L	1.046	0.82
63_Y	132_D	1.043	0.82
18_K	22_R	1.04	0.82
42_P	138_P	1.037	0.82
116_P	131_Q	1.036	0.82
89_D	113_F	1.035	0.82
3_E	22_R	1.035	0.82
96_T	111_T	1.035	0.82
25_P	123_D	1.033	0.81
35_V	86_V	1.029	0.81
34_A	96_T	1.027	0.81
23_L	27_E	1.024	0.81
2_S	26_S	1.023	0.81
12_L	137_Q	1.014	0.80
30_K	66_D	1.006	0.79
15_H	113_F	1	0.78

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1nulA	2	0.9934	100	0.39	Contact Map	0.629
2xbuA	2	0.9934	99.9	0.462	Contact Map	0.54
1vdmA	12	0.9474	99.9	0.465	Contact Map	0.609
3o7mA	4	0.9934	99.9	0.558	Contact Map	0.562
3hvuA	4	0.9934	99.9	0.562	Contact Map	0.489
3ozfA	4	0.9934	99.9	0.563	Contact Map	0.481
2gebA	1	0.9934	99.8	0.567	Contact Map	0.462
1tc1A	2	0.9934	99.8	0.568	Contact Map	0.559
2ywuA	1	0.9934	99.8	0.575	Contact Map	0.52
1yfzA	2	0.9934	99.8	0.575	Contact Map	0.481

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.