OPENSEQ.org - MUG - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

MUG - G/U mismatch-specific DNA glycosylase

UniProt:	P0A9H1	Sequence MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPNPSGLSRVSLEKLVEAYRELDQALVVRGR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12717
Length:	168 (166)
Sequences:	342
Seq/Len:	2.06

MUG
Paralog alert: 0.02 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
6_L	13_V	3.619	1.00
15_C	104_L	3.244	1.00
49_R	55_E	3.209	1.00
28_F	56_A	2.561	1.00
13_V	96_I	2.518	1.00
91_K	95_K	2.086	0.99
72_R	84_E	1.984	0.99
125_K	134_Q	1.956	0.99
157_R	161_Q	1.954	0.99
118_Q	128_L	1.851	0.98
12_V	46_F	1.75	0.97
109_K	123_W	1.7	0.96
20_G	156_Y	1.624	0.95
51_L	62_Y	1.524	0.92
154_E	158_E	1.51	0.92
105_A	138_L	1.485	0.91
96_I	104_L	1.404	0.88
40_V	152_L	1.397	0.87
93_I	97_E	1.374	0.86
42_Y	47_T	1.37	0.86
12_V	64_C	1.354	0.85
104_L	133_T	1.333	0.84
38_W	51_L	1.312	0.82
148_S	151_K	1.285	0.80
58_H	61_D	1.268	0.79
38_W	159_L	1.262	0.79
47_T	50_Q	1.253	0.78
76_Q	79_E	1.251	0.78
109_K	113_E	1.244	0.77
95_K	99_Y	1.244	0.77
42_Y	50_Q	1.243	0.77
71_D	91_K	1.237	0.77
14_F	64_C	1.236	0.77
11_R	102_Q	1.224	0.76
12_V	38_W	1.216	0.75
36_R	40_V	1.213	0.75
43_Q	149_L	1.213	0.75
122_Q	127_T	1.21	0.75
43_Q	153_V	1.196	0.73
24_A	74_T	1.161	0.70
30_F	140_N	1.158	0.70
111_A	152_L	1.156	0.70
17_I	77_A	1.154	0.69
9_G	34_A	1.152	0.69
5_I	51_L	1.15	0.69
107_L	140_N	1.146	0.69
49_R	58_H	1.144	0.68
85_L	106_I	1.144	0.68
31_A	59_L	1.138	0.68
55_E	104_L	1.136	0.68
27_G	32_H	1.132	0.67
22_S	25_G	1.132	0.67
2_V	66_V	1.13	0.67
36_R	152_L	1.121	0.66
97_E	132_S	1.12	0.66
107_L	138_L	1.113	0.65
41_I	68_K	1.112	0.65
130_I	133_T	1.108	0.65
43_Q	150_E	1.107	0.65
50_Q	164_V	1.106	0.65
32_H	153_V	1.098	0.64
30_F	46_F	1.093	0.63
44_A	130_I	1.076	0.62
123_W	146_R	1.071	0.61
42_Y	149_L	1.06	0.60
6_L	99_Y	1.039	0.58
28_F	38_W	1.034	0.57
105_A	136_W	1.031	0.57
48_D	64_C	1.018	0.55
81_S	87_A	1.014	0.55
36_R	143_G	1.007	0.54
141_P	156_Y	1.007	0.54
33_P	68_K	1.005	0.54
59_L	66_V	1.005	0.54
151_K	154_E	1.004	0.54
121_A	146_R	1.004	0.54
46_F	138_L	1.003	0.54

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2l3fA	1	0.9286	100	0.404	Contact Map	0.355
2c2qA	1	0.9881	100	0.438	Contact Map	0.477
1wywA	1	1	100	0.476	Contact Map	0.557
1mugA	1	1	100	0.481	Contact Map	0.627
2d3yA	1	0.9702	99.9	0.657	Contact Map	0.399
1vk2A	1	0.9167	99.9	0.686	Contact Map	0.342
1ui0A	1	0.9167	99.8	0.697	Contact Map	0.421
3ikbA	2	0.9167	98.3	0.86	Contact Map	0.481
1oe4A	2	0.9286	97.8	0.873	Contact Map	0.469
4amuA	4	0.7202	69.2	0.939	Contact Map	0.325

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0412 seconds.