OPENSEQ.org - BAME - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

BAME - Outer membrane protein assembly factor BamE

UniProt:	P0A937	Sequence MRCKTLTAAAAVLLMLTAGCSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGN	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10952
Length:	113 (111)
Sequences:	352
Seq/Len:	3.17

BAME
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
93_L	101_L	3.112	1.00
52_Q	99_G	3.042	1.00
73_W	95_F	1.99	1.00
45_K	58_A	1.93	1.00
28_Y	62_P	1.889	0.99
59_L	91_L	1.786	0.99
72_T	94_T	1.754	0.99
39_T	77_F	1.585	0.97
33_N	77_F	1.536	0.97
54_Q	57_Y	1.518	0.96
66_D	69_G	1.479	0.96
48_V	104_I	1.419	0.94
46_I	53_Q	1.383	0.93
69_G	72_T	1.377	0.93
12_V	15_M	1.37	0.93
16_L	19_G	1.356	0.92
27_V	67_P	1.347	0.92
56_A	61_T	1.297	0.90
94_T	105_D	1.269	0.88
45_K	57_Y	1.264	0.88
44_S	108_P	1.248	0.87
91_L	104_I	1.248	0.87
1_M	4_K	1.242	0.87
29_R	32_I	1.239	0.87
54_Q	73_W	1.23	0.86
93_L	104_I	1.224	0.86
38_L	42_D	1.219	0.86
46_I	107_K	1.198	0.84
50_M	71_N	1.196	0.84
46_I	58_A	1.196	0.84
70_T	76_V	1.194	0.84
81_P	84_E	1.182	0.83
15_M	38_L	1.155	0.81
43_V	106_N	1.15	0.81
31_D	79_Q	1.145	0.80
71_N	103_N	1.135	0.80
85_G	96_N	1.124	0.79
94_T	103_N	1.11	0.77
21_S	51_T	1.101	0.77
29_R	84_E	1.096	0.76
59_L	66_D	1.094	0.76
39_T	44_S	1.086	0.75
33_N	84_E	1.077	0.74
52_Q	111_S	1.076	0.74
57_Y	77_F	1.073	0.74
42_D	90_T	1.065	0.73
61_T	68_F	1.063	0.73
21_S	73_W	1.062	0.73
45_K	104_I	1.054	0.72
39_T	48_V	1.05	0.72
67_P	79_Q	1.047	0.71
69_G	74_F	1.046	0.71
63_L	101_L	1.044	0.71
40_A	44_S	1.042	0.71
108_P	111_S	1.04	0.71
71_N	96_N	1.034	0.70
100_V	105_D	1.031	0.70
38_L	43_V	1.022	0.69
2_R	5_T	1.022	0.69
43_V	91_L	1.013	0.68
37_Y	53_Q	1.001	0.66

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2pxgA	1	0.8142	100	0.388	Contact Map	0.316
2km7A	1	0.8319	99.9	0.44	Contact Map	0.371
2yh9A	3	0.708	99.9	0.505	Contact Map	0.541
4dm5A	4	0.7611	99.8	0.58	Contact Map	0.418
3d4eA	1	0.9027	96.6	0.843	Contact Map	0.374
3gmvX	1	0.6195	96.2	0.851	Contact Map	0.465
3gmxB	2	0.646	96	0.853	Contact Map	0.529
3n4iB	1	0.6549	95.9	0.854	Contact Map	0.501
3zbiC	14	0.4248	80.6	0.898	Contact Map	0.134
1msiA	1	0.5752	46.9	0.919	Contact Map	0.168

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.