OPENSEQ.org - SLYB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

SLYB - Outer membrane lipoprotein SlyB

UniProt:	P0A905	Sequence MIKRVLVVSMVGLSLVGCVNNDTLSGDVYTASEAKQVQNVSYGTIVNVRPVQIQGGDDSNVIGAIGGAVLGGFLGNTVGGGTGRSLATAAGAVAGGVAGQGVQSAMNKTQGVELEIRKDDGNTIMVVQKQGNTRFSPGQRVVLASNGSQVTVSPR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13409
Length:	155 (155)
Sequences:	292
Seq/Len:	1.88

SLYB
Paralog alert: 0.11 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
139_Q	154_P	2.851	1.00
84_R	88_T	2.627	1.00
49_R	113_E	2.603	1.00
76_N	84_R	2.105	0.99
68_A	96_G	2.095	0.99
116_I	124_I	2.012	0.99
63_G	99_G	1.936	0.98
72_G	92_A	1.915	0.98
76_N	88_T	1.776	0.97
102_V	106_M	1.663	0.95
89_A	108_K	1.522	0.91
53_I	111_G	1.497	0.90
21_N	55_G	1.485	0.90
98_A	102_V	1.468	0.89
86_L	90_A	1.429	0.87
113_E	142_V	1.424	0.87
34_A	40_V	1.413	0.86
46_V	123_T	1.403	0.86
93_V	96_G	1.391	0.85
69_V	89_A	1.375	0.84
143_L	146_N	1.359	0.83
119_D	140_R	1.35	0.83
100_Q	104_S	1.287	0.78
26_G	35_K	1.276	0.77
18_C	63_G	1.273	0.77
25_S	28_V	1.262	0.76
9_S	13_L	1.259	0.76
43_G	88_T	1.256	0.76
4_R	10_M	1.255	0.76
37_V	150_V	1.253	0.76
13_L	65_I	1.239	0.74
79_G	83_G	1.226	0.73
45_I	48_V	1.214	0.72
19_V	119_D	1.212	0.72
74_L	97_V	1.211	0.72
4_R	9_S	1.207	0.72
27_D	50_P	1.202	0.71
54_Q	107_N	1.179	0.69
66_G	70_L	1.175	0.69
99_G	103_Q	1.145	0.66
109_T	129_K	1.144	0.66
93_V	97_V	1.124	0.64
44_T	106_M	1.124	0.64
56_G	107_N	1.121	0.63
45_I	85_S	1.115	0.63
66_G	119_D	1.113	0.63
22_D	148_S	1.113	0.63
73_F	85_S	1.078	0.59
56_G	104_S	1.07	0.58
37_V	41_S	1.07	0.58
64_A	78_V	1.067	0.58
4_R	7_V	1.055	0.56
28_V	68_A	1.053	0.56
45_I	116_I	1.047	0.56
63_G	103_Q	1.043	0.55
41_S	124_I	1.041	0.55
48_V	143_L	1.038	0.55
74_L	84_R	1.036	0.54
68_A	103_Q	1.035	0.54
69_V	73_F	1.034	0.54
72_G	91_G	1.028	0.54
12_G	70_L	1.022	0.53
136_S	139_Q	1.018	0.52
45_I	143_L	1.018	0.52
91_G	95_G	1.014	0.52
124_I	153_S	1.014	0.52
45_I	118_K	1.011	0.52
52_Q	110_Q	1.007	0.51
90_A	94_A	1.005	0.51
110_Q	125_M	1.005	0.51
68_A	73_F	1.004	0.51
89_A	100_Q	1.001	0.51

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
3zbiC	14	0.3097	78	0.906	Contact Map	0
3ldtA	1	0.471	34.9	0.929	Contact Map	0.353
2l66A	2	0.2903	30.5	0.931	Contact Map	0.51
2fl7A	1	0.3677	27.5	0.933	Contact Map	0.385
4jjnK	2	0.3484	16.7	0.939	Contact Map	0.356
2do3A	1	0.2452	16.2	0.94	Contact Map	0.245
2ckkA	1	0.3677	13.3	0.942	Contact Map	0.318
1m4zA	2	0.3677	11	0.944	Contact Map	0.33
3j3wP	1	0.2581	10.3	0.945	Contact Map	0.15
1fr3A	12	0.3935	9.3	0.946	Contact Map	0.459

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.