OPENSEQ.org - BLC - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

BLC - Outer membrane lipoprotein blc

UniProt:	P0A901	Sequence MRLLPLVAAATAAFLVVACSSPTPPRGVTVVNNFDAKRYLGTWYEIARFDHRFERGLEKVTATYSLRDDGGLNVINKGYNPDRGMWQQSEGKAYFTGAPTRAALKVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISDEVKQEMLAVATREGFDVSKFIWVQQPGS	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12474
Length:	177 (168)
Sequences:	788
Seq/Len:	4.69

BLC
Paralog alert: 0.18 [within 20: 0.02] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
57_L	78_G	2.94	1.00
65_S	73_N	2.884	1.00
67_R	71_G	2.666	1.00
103_A	117_N	2.564	1.00
122_D	126_R	2.532	1.00
36_A	72_L	2.475	1.00
152_K	171_W	2.426	1.00
138_L	169_F	2.096	1.00
62_A	76_N	1.991	1.00
77_K	88_Q	1.981	1.00
45_E	48_R	1.979	1.00
131_C	164_F	1.976	1.00
34_F	118_V	1.907	1.00
158_V	161_R	1.874	1.00
73_N	90_E	1.863	1.00
71_G	94_Y	1.797	1.00
165_D	168_K	1.797	1.00
140_I	147_I	1.773	1.00
129_L	159_A	1.713	0.99
39_Y	106_V	1.666	0.99
129_L	155_M	1.653	0.99
140_I	155_M	1.638	0.99
77_K	86_W	1.625	0.99
34_F	121_L	1.505	0.98
42_T	63_T	1.505	0.98
71_G	92_K	1.503	0.98
149_D	153_Q	1.492	0.98
127_H	151_V	1.488	0.98
63_T	77_K	1.478	0.98
46_I	142_S	1.463	0.98
35_D	38_R	1.45	0.98
48_R	60_V	1.435	0.98
62_A	106_V	1.422	0.97
91_G	104_L	1.396	0.97
107_S	110_G	1.391	0.97
138_L	164_F	1.367	0.96
119_I	129_L	1.355	0.96
142_S	147_I	1.347	0.96
28_V	135_R	1.346	0.96
40_L	65_S	1.304	0.95
129_L	147_I	1.28	0.94
40_L	66_L	1.273	0.94
16_V	19_C	1.259	0.94
138_L	159_A	1.247	0.93
158_V	162_E	1.244	0.93
39_Y	62_A	1.218	0.92
53_F	137_Y	1.212	0.92
120_A	127_H	1.199	0.91
44_Y	172_V	1.199	0.91
64_Y	76_N	1.195	0.91
120_A	158_V	1.185	0.91
51_H	170_I	1.167	0.90
119_I	131_C	1.156	0.89
45_E	139_W	1.139	0.88
156_L	169_F	1.139	0.88
94_Y	113_Y	1.135	0.88
54_E	139_W	1.128	0.88
34_F	101_R	1.125	0.87
42_T	61_T	1.118	0.87
154_E	158_V	1.089	0.85
102_A	118_V	1.084	0.85
156_L	166_V	1.069	0.84
147_I	155_M	1.068	0.83
37_K	66_L	1.06	0.83
39_Y	76_N	1.056	0.82
155_M	158_V	1.049	0.82
102_A	119_I	1.041	0.81
80_N	87_Q	1.038	0.81
107_S	113_Y	1.03	0.80
120_A	155_M	1.027	0.80
15_L	19_C	1.024	0.80
107_S	112_F	1.022	0.80
6_L	10_A	1.018	0.79
39_Y	141_L	1.002	0.78

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1qwdA	2	0.9887	100	0.295	Contact Map	0.755
3ebwA	2	0.8588	100	0.365	Contact Map	0.549
2hzqA	1	0.8814	100	0.373	Contact Map	0.665
3fmzA	2	0.9718	100	0.375	Contact Map	0.481
1gkaB	1	0.9153	100	0.379	Contact Map	0.483
1kt6A	1	0.8814	100	0.381	Contact Map	0.417
1z24A	1	0.8927	100	0.382	Contact Map	0.373
1kxoA	1	0.887	100	0.391	Contact Map	0.547
3cqnA	2	0.8983	100	0.397	Contact Map	0.412
1i4uA	2	0.9096	100	0.397	Contact Map	0.54

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0651 seconds.