OPENSEQ.org - YJGA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YJGA - UPF0307 protein YjgA

UniProt:	P0A8X0	Sequence MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAEIVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11410
Length:	183 (163)
Sequences:	350
Seq/Len:	2.15

YJGA
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
30_S	34_R	5.187	1.00
45_E	105_K	3.048	1.00
76_E	79_R	2.657	1.00
133_I	152_I	2.395	1.00
60_D	92_R	2.256	1.00
40_K	89_L	2.225	1.00
173_Q	176_R	2.131	1.00
125_L	152_I	1.904	0.99
40_K	83_Q	1.902	0.99
38_E	98_R	1.897	0.99
43_G	86_G	1.756	0.97
47_V	82_L	1.667	0.96
116_H	169_R	1.627	0.95
87_K	91_Q	1.626	0.95
73_I	77_G	1.532	0.93
83_Q	86_G	1.515	0.93
31_E	35_D	1.478	0.91
168_A	173_Q	1.449	0.90
128_Q	132_A	1.445	0.90
36_A	40_K	1.441	0.90
166_K	170_Q	1.44	0.90
125_L	133_I	1.374	0.87
136_V	143_A	1.368	0.86
136_V	175_L	1.367	0.86
36_A	89_L	1.366	0.86
165_P	169_R	1.36	0.86
119_E	122_R	1.332	0.84
92_R	96_P	1.327	0.84
79_R	83_Q	1.299	0.82
143_A	178_L	1.283	0.81
57_I	104_L	1.277	0.81
124_R	128_Q	1.241	0.78
71_Q	81_Q	1.239	0.78
135_E	139_L	1.23	0.77
42_L	169_R	1.23	0.77
115_F	168_A	1.219	0.76
118_L	175_L	1.211	0.76
35_D	159_K	1.195	0.74
84_L	92_R	1.186	0.74
137_L	145_R	1.179	0.73
31_E	34_R	1.167	0.72
69_L	72_R	1.165	0.72
61_A	64_R	1.165	0.72
68_E	72_R	1.157	0.71
49_L	63_L	1.136	0.69
129_G	132_A	1.133	0.69
156_K	160_E	1.133	0.69
79_R	86_G	1.133	0.69
43_G	79_R	1.131	0.68
83_Q	90_R	1.125	0.68
46_I	54_L	1.118	0.67
129_G	145_R	1.115	0.67
59_L	88_M	1.111	0.66
29_K	97_I	1.11	0.66
122_R	172_F	1.11	0.66
77_G	85_I	1.105	0.66
172_F	176_R	1.102	0.66
123_D	168_A	1.095	0.65
70_A	81_Q	1.09	0.64
57_I	124_R	1.084	0.64
78_R	171_I	1.083	0.64
123_D	159_K	1.08	0.63
130_D	156_K	1.078	0.63
98_R	140_W	1.075	0.63
158_E	164_P	1.074	0.63
121_L	136_V	1.073	0.63
47_V	67_I	1.07	0.62
55_D	64_R	1.07	0.62
77_G	92_R	1.065	0.62
132_A	135_E	1.06	0.61
98_R	102_D	1.053	0.60
83_Q	89_L	1.043	0.59
166_K	176_R	1.042	0.59
87_K	90_R	1.039	0.59
30_S	154_N	1.03	0.58
40_K	86_G	1.029	0.58
48_D	78_R	1.012	0.56
43_G	83_Q	1.011	0.56
121_L	124_R	1.008	0.55
112_V	115_F	1.005	0.55

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2p0tA	1	0.9399	100	0.093	Contact Map	0.446
2k7rA	1	0.3716	48.7	0.94	Contact Map	0.436
4m4wJ	6	0.4536	19.1	0.951	Contact Map	0.664
3e3vA	1	0.7432	12.7	0.955	Contact Map	0.344
3vj8A	1	0.694	12.2	0.955	Contact Map	0.266
3sfzA	1	0.6066	9.8	0.957	Contact Map	0.3
2d4eA	4	0.4973	9.1	0.958	Contact Map	0.088
1ichA	1	0.5301	7.6	0.959	Contact Map	0.279
4knaA	2	0.4044	7.5	0.959	Contact Map	0.127
1o3xA	1	0.5519	7.2	0.96	Contact Map	0.307

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0142 seconds.