OPENSEQ.org - FETP - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

FETP - Probable Fe(2+)-trafficking protein

UniProt:	P0A8P3	Sequence MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQTMLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTPEDKK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12984
Length:	91 (90)
Sequences:	326
Seq/Len:	3.62

FETP
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
18_D	36_K	2.757	1.00
28_K	32_N	2.704	1.00
12_R	37_E	2.308	1.00
69_E	72_N	2.211	1.00
15_E	36_K	2.085	1.00
65_L	80_V	2.069	1.00
3_R	16_G	2.06	1.00
6_F	11_Q	2.037	1.00
10_L	37_E	1.624	0.98
59_N	62_H	1.614	0.98
37_E	41_Q	1.559	0.98
25_E	28_K	1.547	0.98
64_K	68_Q	1.541	0.98
3_R	31_Y	1.535	0.97
8_T	34_I	1.509	0.97
20_Q	31_Y	1.5	0.97
26_L	29_R	1.476	0.97
29_R	75_F	1.381	0.95
5_I	17_Q	1.371	0.94
74_L	77_G	1.333	0.93
10_L	14_A	1.323	0.93
16_G	31_Y	1.311	0.92
53_K	69_E	1.299	0.92
57_M	67_E	1.256	0.90
22_Y	70_M	1.243	0.89
5_I	34_I	1.221	0.88
22_Y	67_E	1.186	0.86
56_N	60_A	1.17	0.85
14_A	37_E	1.169	0.85
20_Q	32_N	1.163	0.85
48_M	85_Y	1.156	0.84
69_E	81_H	1.142	0.83
43_Q	50_I	1.125	0.82
63_R	70_M	1.117	0.81
41_Q	73_F	1.074	0.78
14_A	54_K	1.063	0.77
50_I	72_N	1.055	0.76
11_Q	60_A	1.051	0.76
10_L	35_S	1.034	0.74
29_R	33_E	1.026	0.73
9_F	62_H	1.022	0.73
10_L	75_F	1.016	0.72
52_E	85_Y	1.003	0.71
18_D	31_Y	1.003	0.71

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1xs8A	1	1	100	-0.003	Contact Map	0.386
1t07A	1	1	100	0.004	Contact Map	0.574
3ljbA	2	0.8462	18.1	0.934	Contact Map	0.329
2owlA	2	0.5275	17.4	0.934	Contact Map	0.209
2owyA	2	0.5165	11.9	0.939	Contact Map	0.349
2vooA	2	0.4505	7.8	0.944	Contact Map	0.654
2qm4A	4	0.4176	7.5	0.944	Contact Map	0.409
2m0gA	1	0.7582	7.3	0.944	Contact Map	0.22
2m09A	1	0.7582	6.9	0.945	Contact Map	0.217
2wb0X	1	0.8462	6.5	0.946	Contact Map	0.156

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.015 seconds.