OPENSEQ.org - RLMH - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

RLMH - Ribosomal RNA large subunit methyltransferase H

UniProt:	P0A8I8	Sequence MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGKNADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11254
Length:	155 (155)
Sequences:	1238
Seq/Len:	7.99

RLMH
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
78_P	124_A	2.967	1.00
19_G	134_V	2.948	1.00
71_T	108_L	2.627	1.00
6_V	60_M	2.462	1.00
110_P	114_A	2.317	1.00
123_S	127_L	2.273	1.00
85_A	147_T	2.169	1.00
145_S	150_H	2.164	1.00
127_L	135_L	2.16	1.00
57_G	112_C	2.104	1.00
128_P	131_L	2.104	1.00
74_I	121_S	2.006	1.00
87_E	118_Q	1.964	1.00
15_W	19_G	1.95	1.00
71_T	116_A	1.919	1.00
61_L	112_C	1.885	1.00
57_G	109_S	1.845	1.00
84_L	143_A	1.843	1.00
83_Q	124_A	1.779	1.00
4_Q	34_E	1.738	1.00
30_D	150_H	1.737	1.00
89_E	147_T	1.727	1.00
69_I	101_L	1.714	1.00
17_Q	21_T	1.692	1.00
122_L	132_V	1.646	1.00
24_L	33_F	1.642	1.00
79_W	118_Q	1.621	1.00
106_E	154_R	1.583	1.00
16_V	19_G	1.562	1.00
8_V	38_I	1.557	1.00
54_D	109_S	1.534	1.00
69_I	115_A	1.515	1.00
58_E	111_A	1.515	1.00
75_P	113_K	1.504	1.00
82_P	155_E	1.497	1.00
61_L	115_A	1.476	0.99
7_A	133_R	1.46	0.99
120_W	125_L	1.457	0.99
2_K	34_E	1.427	0.99
5_L	136_V	1.423	0.99
54_D	111_A	1.416	0.99
68_R	117_E	1.409	0.99
53_L	113_K	1.396	0.99
60_M	101_L	1.383	0.99
48_D	51_R	1.349	0.99
105_P	154_R	1.349	0.99
86_A	89_E	1.347	0.99
80_D	83_Q	1.34	0.99
64_A	69_I	1.337	0.99
58_E	62_A	1.313	0.98
20_F	137_A	1.29	0.98
79_W	87_E	1.279	0.98
18_T	21_T	1.27	0.98
14_D	18_T	1.251	0.98
41_G	59_Q	1.251	0.98
89_E	93_L	1.244	0.98
81_T	146_I	1.237	0.97
16_V	134_V	1.236	0.97
100_L	136_V	1.224	0.97
73_D	113_K	1.214	0.97
55_K	58_E	1.198	0.97
57_G	61_L	1.189	0.96
111_A	114_A	1.173	0.96
87_E	91_W	1.169	0.96
2_K	45_K	1.142	0.95
113_K	119_S	1.137	0.95
4_Q	36_I	1.134	0.95
74_I	82_P	1.126	0.95
43_R	52_I	1.109	0.94
21_T	24_L	1.108	0.94
33_F	137_A	1.106	0.94
22_E	26_R	1.101	0.94
79_W	125_L	1.098	0.94
20_F	134_V	1.095	0.94
4_Q	97_D	1.081	0.93
49_I	53_L	1.073	0.93
5_L	33_F	1.062	0.92
92_K	147_T	1.061	0.92
86_A	90_R	1.055	0.92
71_T	113_K	1.047	0.92
70_V	91_W	1.044	0.92
71_T	119_S	1.04	0.91
73_D	116_A	1.031	0.91
27_F	31_M	1.031	0.91
110_P	113_K	1.027	0.91
132_V	135_L	1.025	0.91
4_Q	99_S	1.018	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1to0A	8	1	100	-0.038	Contact Map	0.894
1ns5A	2	1	100	-0.031	Contact Map	0.748
4fakA	1	0.9935	100	-0.03	Contact Map	0.764
1o6dA	1	0.9548	100	-0.002	Contact Map	0.701
3oiiA	2	0.8839	99.7	0.652	Contact Map	0.42
1ualA	1	0.9484	91.4	0.899	Contact Map	0.509
1oy5A	3	0.9419	91.2	0.9	Contact Map	0.558
4mcdA	1	0.9484	90.6	0.901	Contact Map	0.511
3iefA	2	0.9484	90.4	0.902	Contact Map	0.574
3quvA	2	0.9419	90.3	0.902	Contact Map	0.504

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0462 seconds.